KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2178Help
Entry
SACOL2178         CDS       T00225                                 

Definition
alcohol dehydrogenase, zinc-containing (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:sac01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sac00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sac00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:sac00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sac00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:sac00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2260085..2261086)
Genome map
AA seq 333 aa AA seqDB search
MQNKQILFNKIPEGMPQEDTFKIEEIDTPKLESDGVLVQTLYISVDPYMRGRMTKADSYV
QPFEIGKPIVSHVVAKVIDSTLADYKKGDVVVGMLPWRIINHVQADQITKVPTTDVPLDL
YLSVLGMPGQTAYHGLLDIGQPKAGDTVVVSAASGAVGSVVGQIAKIKGCRVVGIAGGDK
KVNYLTETLGFDAGIDYKKEDFAEALAQAVPDGIDVYFENVGGTVGDEVFKHLNRFARVP
VCGAISSYNHPEADIGPRIQGTLIKKQVMMRGFLVSEFANAFKEASEQLATWVQEGKIQS
QVTIEDGFENAPHAFKNLFTGDNFGKQVIKVTE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataaacaaattctttttaacaaaataccagaaggcatgcctcaagaggataca
ttcaaaattgaagagattgacacgcctaaacttgagagcgatggtgtacttgtacaaacg
ctgtatatttcagtggatccatatatgagaggacgtatgactaaggcagattcgtatgta
cagccttttgaaattggtaaaccgattgttagccatgtcgttgcaaaagtaattgattcg
acactcgcagattataaaaaaggagatgtcgttgtaggtatgttgccttggcgaatcatt
aatcatgtccaagcggatcaaattactaaagttccaacgacagatgtaccacttgattta
tatttaagtgttttaggaatgccaggacaaacagcatatcatggtctgcttgatattgga
caacctaaagccggtgatactgttgtggtttcagctgcatctggtgctgtaggttcagtt
gtaggtcaaattgctaagattaaaggttgccgtgtagtaggtattgcgggtggcgacaaa
aaagtaaattatttaacagagacactgggctttgacgctggtattgattataagaaagag
gattttgcagaagcgttagcacaagcagtaccagatggtattgatgtttattttgaaaat
gttggtggaacagttggcgatgaagtatttaagcatttaaatcgttttgcacgtgtacca
gtatgtggcgcaatttcgtcatataatcatcctgaagccgatatcggaccacgtattcaa
ggtacgcttattaagaagcaagtaatgatgagaggcttcttggtaagtgaattcgctaat
gcttttaaagaagctagtgaacagcttgcaacatgggttcaagaaggtaaaattcagtca
caagtaaccattgaagatggttttgaaaatgcgccacatgcatttaaaaatttatttact
ggcgataactttggtaaacaagttattaaagtaacggaataa

DBGET integrated database retrieval system