KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2178Help
Entry
SACOL2178         CDS       T00225                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K07119  
uncharacterized protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2260085..2261086)
Genome map
AA seq 333 aa AA seqDB search
MQNKQILFNKIPEGMPQEDTFKIEEIDTPKLESDGVLVQTLYISVDPYMRGRMTKADSYV
QPFEIGKPIVSHVVAKVIDSTLADYKKGDVVVGMLPWRIINHVQADQITKVPTTDVPLDL
YLSVLGMPGQTAYHGLLDIGQPKAGDTVVVSAASGAVGSVVGQIAKIKGCRVVGIAGGDK
KVNYLTETLGFDAGIDYKKEDFAEALAQAVPDGIDVYFENVGGTVGDEVFKHLNRFARVP
VCGAISSYNHPEADIGPRIQGTLIKKQVMMRGFLVSEFANAFKEASEQLATWVQEGKIQS
QVTIEDGFENAPHAFKNLFTGDNFGKQVIKVTE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataaacaaattctttttaacaaaataccagaaggcatgcctcaagaggataca
ttcaaaattgaagagattgacacgcctaaacttgagagcgatggtgtacttgtacaaacg
ctgtatatttcagtggatccatatatgagaggacgtatgactaaggcagattcgtatgta
cagccttttgaaattggtaaaccgattgttagccatgtcgttgcaaaagtaattgattcg
acactcgcagattataaaaaaggagatgtcgttgtaggtatgttgccttggcgaatcatt
aatcatgtccaagcggatcaaattactaaagttccaacgacagatgtaccacttgattta
tatttaagtgttttaggaatgccaggacaaacagcatatcatggtctgcttgatattgga
caacctaaagccggtgatactgttgtggtttcagctgcatctggtgctgtaggttcagtt
gtaggtcaaattgctaagattaaaggttgccgtgtagtaggtattgcgggtggcgacaaa
aaagtaaattatttaacagagacactgggctttgacgctggtattgattataagaaagag
gattttgcagaagcgttagcacaagcagtaccagatggtattgatgtttattttgaaaat
gttggtggaacagttggcgatgaagtatttaagcatttaaatcgttttgcacgtgtacca
gtatgtggcgcaatttcgtcatataatcatcctgaagccgatatcggaccacgtattcaa
ggtacgcttattaagaagcaagtaatgatgagaggcttcttggtaagtgaattcgctaat
gcttttaaagaagctagtgaacagcttgcaacatgggttcaagaaggtaaaattcagtca
caagtaaccattgaagatggttttgaaaatgcgccacatgcatttaaaaatttatttact
ggcgataactttggtaaacaagttattaaagtaacggaataa

DBGET integrated database retrieval system