KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2332Help
Entry
SACOL2332         CDS       T00225                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACOL2332 (galM)
   00052 Galactose metabolism
    SACOL2332 (galM)
Enzymes [BR:sac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SACOL2332 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2393840..2394859)
Genome map
AA seq 339 aa AA seqDB search
MIVEVEHQRQGVDLIKIDNDETKIIFTNYGARVVSWKYHDNNIVLGNVVEADEFYHSNPF
KFGASIGRYSGRIDNAKFKLKGKEYQLEKNNGEHHLHGGCHGLDNKLFDYEIRNEIAQIK
VIFKTVLKSADDHFPGDIDVTITHIYDADHQWSIEYEAVASEDTLFSPTNHVYFNLNRDN
NVVDNHRISSNQLDMYVLDERNIVTGDILDLHEVFEDNKIKLSDIFTSQHAQLSQQMTRF
GGLDHPFTVGEHKMYVENHEFMLEVDTDMPHVVFFTFNQPDEWDSPFNIYKPHSGFTLET
QFLPNDINLYGEKAPSILKAGEVFNSKTSFRIEEKVEND
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatagttgaagttgagcaccaaagacaaggtgtagatttaatcaaaattgataatgat
gaaactaaaattatttttacgaattatggagcaagagtagtgtcttggaaatatcatgat
aataatattgttcttggaaatgttgttgaagcggatgaattttatcatagtaatcctttt
aaatttggtgcttctataggaagatatagcggtagaattgataatgctaaatttaagttg
aaaggtaaagaatatcagttagaaaaaaacaacggtgaacatcatttacatggtggatgt
catggtttggacaataagttatttgattatgaaattagaaatgaaattgctcaaattaaa
gttatatttaagacggtgttgaaatcagctgatgatcatttcccgggtgatatcgatgtg
acgattacacatatttatgatgcggatcaccaatggtcgattgaatacgaagcagttgca
tcagaagacacattgtttagtcctacgaatcatgtgtacttcaatttgaatcgagataat
aatgtcgttgataatcatcgcatttcaagtaatcaattagatatgtatgtattagatgag
cgaaatattgttacaggtgatattctagatttacatgaagtgtttgaagataacaagata
aaattgagtgatatttttacatcacaacatgcgcaattaagccaacaaatgacacgtttt
ggtggtctcgatcacccatttacagttggtgaacataaaatgtatgttgaaaatcatgaa
tttatgttagaggtcgatacagatatgcctcatgttgtgttctttacttttaaccagcct
gatgagtgggatagtccatttaatatttataaaccacattctggctttacattagaaaca
caatttttaccaaatgatattaatttatatggtgaaaaagcaccgtcaattttaaaagct
ggtgaagtgttcaattcgaaaacaagtttccgtatcgaagaaaaagtagaaaatgattaa

DBGET integrated database retrieval system