KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2367Help
Entry
SACOL2367         CDS       T00225                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00010  Glycolysis / Gluconeogenesis
sac00071  Fatty acid degradation
sac00350  Tyrosine metabolism
sac00625  Chloroalkane and chloroalkene degradation
sac00626  Naphthalene degradation
sac01100  Metabolic pathways
sac01110  Biosynthesis of secondary metabolites
sac01120  Microbial metabolism in diverse environments
sac01130  Biosynthesis of antibiotics
sac01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACOL2367
  Lipid metabolism
   00071 Fatty acid degradation
    SACOL2367
  Amino acid metabolism
   00350 Tyrosine metabolism
    SACOL2367
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SACOL2367
   00626 Naphthalene degradation
    SACOL2367
Enzymes [BR:sac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SACOL2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 ADH_N_2 ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AAW37194
UniProt: A0A0H2WWX6
Position
2427736..2428740
Genome map
AA seq 334 aa AA seqDB search
MIETFKAFVIDKDESGKVTPTFKQLSPTDLPKGDVLIKVHYSGINYKDALATQDHNAVVK
SYPMIPGIDLAGTIVESEAPGFEKGEQVIVTSYDLGVSHYGGFSEYARVKSEWIIKLPDT
LTLEESMIYGTAGYTAGLAIERLEKVGMNIEDGPVLVRGASGGVGTLAVLMLNELGYKVI
ASTGKQDVSDQLLELGAKEVIDRLPVEDDHKKPLASSTWQACVDPVGGEGINYVTKRLNH
SGSIAVIGMTAGNTYTNSVFPHILRGVNILGIDSVFTAMKLRQRVWRRLAKDLMPENLHE
IKQVITFDELPEQLNKVIKHENKGRIVIDFGVDK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgatagaaacatttaaagcgtttgtaattgataaagatgagagtggtaaagtgacacca
actttcaaacaattatcgcctactgatttacctaaaggagatgtgctgattaaagtacat
tactctggtataaattataaagatgctttagcgactcaagaccataatgcagtcgtaaaa
tcgtatcctatgattccaggaatagatttagctggaacaattgttgaatccgaagcacca
ggctttgaaaaaggagaacaagtaattgtaacgagttatgacctaggtgtcagccattat
ggcggttttagtgaatatgcgcgtgtaaaatcagaatggattatcaagcttcctgatact
ttaacattagaagaatcaatgatatatggcacagctggttatactgccggtttagcaatt
gaaagacttgaaaaagttggaatgaatattgaagatggtcctgtactcgttcgcggtgct
tcaggtggtgtcggtactttagcagtactcatgcttaatgaacttggttataaagttatc
gcaagtacaggtaaacaagatgttagcgatcaattacttgaacttggtgccaaagaagtt
atcgatcgacttcctgttgaagatgatcataaaaagccactcgcatcatcaacttggcaa
gcttgtgtagaccctgttggtggcgaaggtattaattatgttacaaagcgtttaaatcat
agtgggtcaattgcagttattggtatgactgccggtaatacttatactaattctgtattc
cctcacattttaagaggtgtaaacattttaggaattgactcggtatttactgctatgaaa
ttaagacagcgcgtttggcgtcgtctcgcaaaagatttaatgcctgaaaatttacatgag
atcaagcaagttattacatttgatgaacttccagaacaacttaacaaagtaattaaacat
gaaaataaagggcgcattgttatcgatttcggtgtagataaatag

DBGET integrated database retrieval system