KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2415Help
Entry
SACOL2415         CDS       T00225                                 

Gene name
gpm
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00010  Glycolysis / Gluconeogenesis
sac00260  Glycine, serine and threonine metabolism
sac00680  Methane metabolism
sac01100  Metabolic pathways
sac01110  Biosynthesis of secondary metabolites
sac01120  Microbial metabolism in diverse environments
sac01130  Biosynthesis of antibiotics
sac01200  Carbon metabolism
sac01230  Biosynthesis of amino acids
Module
sac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sac_M00002  Glycolysis, core module involving three-carbon compounds
sac_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACOL2415 (gpm)
  Energy metabolism
   00680 Methane metabolism
    SACOL2415 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SACOL2415 (gpm)
Enzymes [BR:sac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SACOL2415 (gpm)
Membrane trafficking [BR:sac04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SACOL2415 (gpm)
Exosome [BR:sac04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SACOL2415 (gpm)
  Exosomal proteins of melanoma cells
   SACOL2415 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAW37240
UniProt: Q5HDD9
Position
complement(2474088..2474774)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattgattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system