KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2527Help
Entry
SACOL2527         CDS       T00225                                 

Definition
(GenBank) fructose-1,6-bisphosphatase, putative
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00010  Glycolysis / Gluconeogenesis
sac00030  Pentose phosphate pathway
sac00051  Fructose and mannose metabolism
sac00680  Methane metabolism
sac01100  Metabolic pathways
sac01110  Biosynthesis of secondary metabolites
sac01120  Microbial metabolism in diverse environments
sac01130  Biosynthesis of antibiotics
sac01200  Carbon metabolism
Module
sac_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACOL2527
   00030 Pentose phosphate pathway
    SACOL2527
   00051 Fructose and mannose metabolism
    SACOL2527
  Energy metabolism
   00680 Methane metabolism
    SACOL2527
Enzymes [BR:sac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SACOL2527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 GP24_25
Motif
Other DBs
NCBI-ProteinID: AAW37304
UniProt: Q5HD37
Position
2587978..2589942
Genome map
AA seq 654 aa AA seqDB search
MTQITEKELKKKYLDLLSQNFDTPEKLATEIINLESILELPKGTEHFVSDLHGEYEAFQH
VLRNGSGNVRAKINDIFKERLSTKELNDLTALVYYPEDKLKLIKSDFQNCGQLNVWYITT
IEHLIELIKYCSSKYTRSKLRKALPKQYVYIIEELLYKSNEYQNKKSYYETLVNQVIELK
QADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYHSLDIQWGNHDVLWVG
AYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKYYDADNPAFKPKKRPDKH
ERLTQREESQITKIHQAIAMIQFKLEIPIIKRRPNFEMEERLVLEKVNYDTNEITVYGNT
YPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRKGSLYLPYNGN
LLIHGCIPVDENGEMESFEIDGHTYSGQELLDVFEYHVRKSFDEKENTDDLSTDLVWYLW
TGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVRKMLSDFGLNPDEGRI
INGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQQFN
AKEKILSEGIDELSIKRVVDKELQRKKIRDTNIGKDLQAQIDILKMLMHDRYLD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaattactgaaaaagaattaaaaaagaagtatttagatttactatcccaaaat
tttgatactccagaaaaacttgcaactgaaattatcaatttagaatcaattttagaatta
cctaaaggtacggaacatttcgtcagcgatttacatggtgaatatgaagctttccaacac
gtattacgcaacggttctgggaacgtgcgagcgaaaatcaatgatattttcaaagagaga
ctttcaactaaggagcttaatgacttaactgctcttgtctactatccagaagacaaatta
aaattgattaaaagtgatttccaaaattgcggtcaacttaatgtctggtatatcacaaca
atcgaacatttaattgagttaattaaatattgttcttcaaaatatacgcgttcaaaactg
cgtaaagcattgccaaaacaatacgtttatattattgaggaactactgtataaaagtaat
gaatatcaaaataaaaaatcatattacgaaacacttgttaaccaagtaattgaacttaaa
caggcagatgatttaattattggactcgcttattccgtacaacgcttagtcgtcgatcat
ttacacgttgtcggtgatatttatgatcgtggaccacaaccagataaaattatggataca
ctgattaattatcattccctagatattcaatggggtaatcatgatgtgctttgggttgga
gcctatgctgggtcaaaagtatgcttagcaaacttacttcgaatttgtgcacgttatgat
aatttagatattatcgaagacgcttatggcattaatttaagaccactgcttactttagct
gaaaaatactatgacgcagataatcctgcttttaagcctaaaaaaagacctgacaaacac
gaacgtttaactcaacgtgaagaaagtcaaattactaaaattcatcaagctattgcgatg
attcaattcaagttagaaataccaattattaaacgtcgtccaaatttcgaaatggaagaa
cgtcttgtgcttgaaaaggttaattatgatacaaatgaaattacagtttatggtaataca
tacccattgaaagacacatgtttccaaactgtcaatcgtgataatccagcagaattacta
cctgaagaagaagaagtcatgaataaactattattgtcattccaacaatctgaaaaatta
cgtcgtcatatgtctttcttgatgcgtaaaggctctctttacttaccatataatggcaat
ttactcattcatggttgtattccagttgatgaaaatggtgagatggaatcatttgaaatt
gatggtcatacttacagcggccaagaattattagatgtgtttgagtatcatgtccgtaaa
tcatttgatgaaaaagaaaatactgatgacttatcgacggatttagtttggtatttatgg
actgggaaatattcgtcactatttggtaaacgtgccatgactacgtttgagcgatacttt
attgcagataaagcttctcataaagaagaaaagaatccgtactatcatcttcgtgaagat
gtgaatatggttcgtaaaatgctcagtgatttcggattaaatccagatgaaggacgcatt
attaatggtcacacaccagtgaaagaaatcaatggcgaagatcctatcaaggctgatgga
aagatgcttgtcattgatggtggcttttcaaaagcttatcagtcaacaactggcattgca
ggctatacactattgtataattcattcggtatgcaactcgttgcacaccaacaatttaac
gctaaagaaaaaatactttccgaaggtatcgatgaactttctataaagcgcgtcgtagat
aaagaattacaacgtaagaagattcgtgataccaatattggtaaagatcttcaagctcaa
atagatattttgaaaatgttaatgcatgatcgttacttagactaa

DBGET integrated database retrieval system