KEGG   Singulisphaera acidiphila: Sinac_0071Help
Entry
Sinac_0071        CDS       T02393                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
saci  Singulisphaera acidiphila
Brite
Enzymes [BR:saci01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Sinac_0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
90283..91683
Genome map
AA seq 466 aa AA seqDB search
MRSGWFVRGILRMGVSVMVLVAPLIAWGDEDQAVAPEPQEKALPRLPPRAQEPADVRAER
IAGLRRDEDQAVAPEPQEKALPRLPPRAQEPADVRAERIAGLRQVYEGPPSGWPRPNVDP
GVEWVELGTLPPVAQPDENPPTAAKVALGKMLFFDPRLSGSGQIACASCHDPDLGWADGR
TTSFGHDRQALPRNAPGLLNVGQARSLFWDGRAATLEDQARVVILNPHEMNAPAEATVAA
VAKVPGYRPAFQEAFGSDDVTLDAVARALAAFERTLVGGRSKFDAFLKGNPKALTDEAIA
GLDLFRGAARCLNCHNGPTFSDNQFHDLGLSYYGRTLEDLGRYQITGEADDVGRFRTPSL
RNIGNTKPYMHNGVFELDGVLRMYNAGMATLRRPTGEPKPDAAPFPTKSPLLRPLGLNDR
DLADLKAFLESLNEPRGFRRPPILPPSDPELKQNLNRNLTPPAADR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcagggtggtttgttcgcgggatcttgaggatgggcgtttccgtgatggtgctg
gtcgcgcctctgatcgcctggggcgacgaagatcaggccgtcgctcccgagccgcaggag
aaggcgttgccccggctcccgccccgggctcaggagcctgctgacgttcgcgcggagcgg
atcgccgggctgcgacgcgacgaagatcaggccgtcgctcccgagccgcaggagaaggcg
ttgccccggctcccgccccgggctcaggagcctgctgacgttcgcgcggagcggatcgcc
gggctgcgacaagtctatgaagggcctccttcgggatggcccaggccgaacgtcgacccg
ggggtggagtgggtcgaactgggaacgctgccgccggtggcccaacccgatgagaacccg
ccgacggcggcgaaggtcgcgctgggcaaaatgttgttcttcgacccaaggctgtcgggc
agcggacagatcgcgtgcgcgtcgtgccatgaccccgacctcggatgggctgacggccgg
accacctccttcggacacgaccgccaggcgctcccgcggaacgcgcccgggctgctgaac
gtcggccaggcgcggagcctgttctgggacggccgggccgcgacactcgaggatcaggcc
cgcgtcgtgatcttgaaccctcacgagatgaacgccccagccgaggcgacggtggcggct
gtggccaaggtgcccggctatcgccctgcgtttcaggaggcgttcgggtcggacgacgtg
acgctcgacgccgtcgcccgcgccctcgccgcgttcgagcggacgctggtcggcggccgg
agcaagttcgacgccttcctcaaagggaaccccaaggcgctgaccgacgaggcgatcgcc
gggctcgacctgttccgaggcgcagcgcgttgcctgaactgccacaacgggccaaccttc
agcgacaaccaattccacgacctcggcctgagctattacgggcggacactcgaagacctc
ggccgctaccagatcaccggagaggccgacgacgtcggccgattccgcacgcccagcctc
cgcaacatcggcaacaccaagccctacatgcacaacggggtcttcgaactcgacggggtg
ttgcgaatgtacaacgccggcatggcgaccctccgacggccgaccggcgaaccgaaaccg
gacgccgcacctttccccaccaaatcgccgctgcttcgccccctcggactgaacgatcgg
gatctcgccgacctcaaagcgttcctcgaatccctcaacgagccccgcggcttccgccgc
ccccccatcctcccaccaagcgaccccgaattgaaacagaatctcaatcgcaacttgacg
cccccggcggccgaccggtaa

DBGET integrated database retrieval system