KEGG   Singulisphaera acidiphila: Sinac_1312Help
Entry
Sinac_1312        CDS       T02393                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
saci  Singulisphaera acidiphila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:saci00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sinac_1312
DNA repair and recombination proteins [BR:saci03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sinac_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1645555..1646160
Genome map
AA seq 201 aa AA seqDB search
MAGYSGTVDRLIDAFGRLPGVGAKTAERLAHHLLKCPAEEALALADAIRDVRERVRHCQT
CYHLTEAEHPLCGICRDPRRDASVVCVVEQPRDLLALEKAGTFRGVYHVLLGRLAPLQGM
GPDQLTLPALEARVRSGTIQELIMATNPNLEGDGTALLVANRLADSGVPITRLARGLASG
SVLEFANKEMLADAINGRQRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcgggttactcgggcacggttgaccggctgatcgatgcgttcggccgcttgccgggc
gtgggggcgaaaaccgccgaacgtctggcccaccacctcctcaagtgccctgccgaagaa
gccttggccttggccgatgcgattcgcgatgtccgggaacgggttcggcattgccagacc
tgctaccacctgacggaagccgaacaccccctctgcggcatctgtcgcgaccccaggcgt
gacgcgtcggtcgtctgcgttgtcgagcaaccgcgcgacctgctcgccctcgagaaggcg
ggcacgttccgaggcgtctatcacgtgctgctcggccggctcgcgcctttgcaagggatg
ggccctgaccagttgaccctccccgcgcttgaagcccgcgtccgttccgggacgattcag
gagttgatcatggcgaccaacccgaacctcgaaggggacggcaccgcgctcctggtcgcg
aatcgattggccgactccggggtcccaatcacacggctggcccgaggcctcgcctcggga
agcgtcctggaattcgccaataaagaaatgcttgctgatgcaattaacggtcgccagcgt
ttttga

DBGET integrated database retrieval system