KEGG   Singulisphaera acidiphila: Sinac_1525Help
Entry
Sinac_1525        CDS       T02393                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
saci  Singulisphaera acidiphila
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sinac_1525
   00051 Fructose and mannose metabolism
    Sinac_1525
Enzymes [BR:saci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Sinac_1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1921260..1922306
Genome map
AA seq 348 aa AA seqDB search
MANGASPTNYRFSFGPWNISTGADPFGPPARKEIDFARKIRAYKELGFDAVQMHDDDIVS
ADLDWPATLKGVAQVKSMLDGEGLFVEIVAPRLWEDPRTVDGGFTSNSASDRKYALDRAK
RTVDIAREVGCRNYVLWLAREGTYIREAKDAKTAVGRIVEAWNTILEHDPDIRVMGEAKP
NEPMDQAYLPTVGHMIGIAYKTVDPSRSGVLIESAHSILAGLDPADDMAYALYHDKLWSV
HLNDQNGLKYDQDKVFGSVDLRRAFDQVLTLETNGYGRNGECVGLDVKAMRTTTVEDSMQ
HLSNSRTMFLRLLEIVRELDLKQVEVLREARQYEQLEMLILNALTGRK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggccaacggtgcctcgcccaccaactaccggttttctttcggcccctggaacattagc
actggcgccgacccctttggcccccctgcccggaaagaaatcgacttcgcccgcaagatc
agagcgtacaaagaactcggcttcgatgccgtacaaatgcacgacgatgacatcgtttcg
gccgacctcgactggcctgccacgctcaaaggggtggcccaggtcaagtcgatgctcgac
ggcgagggcctgttcgtcgagatcgtcgccccccggctctgggaagatccccgaacggtc
gacggcggattcacatccaacagcgcgagcgaccgcaagtacgccctcgatcgggccaag
cgaaccgtcgatatcgcccgcgaagtcggctgccgcaactacgtgctctggcttgctcgc
gaaggaacctacatccgcgaggccaaggacgccaagaccgcggtcgggcggatcgtcgaa
gcctggaacaccatcctcgagcatgacccggacatccgcgtgatgggcgaggccaagccc
aacgagccgatggatcaggcctatctgcccaccgtcggccacatgatcgggatcgcctac
aagacggtcgacccgagccgctccggtgttctgatcgagagcgctcactccattctcgcg
ggcctggatccggccgacgacatggcgtacgcactctatcacgacaagctctggagcgtc
cacctgaacgatcagaacggcctcaagtacgatcaggacaaggtcttcggttccgtcgac
ctgcgccgggcgttcgaccaggtgctgaccctcgagaccaacgggtatggccgcaacggc
gaatgcgtgggcctcgacgtgaaggcgatgcgcaccaccaccgtcgaagactcgatgcag
catctcagcaactcgaggacgatgttcctgcgcctgctcgagatcgttcgcgaactcgac
ctgaagcaggtcgaggtactccgagaggcgcggcagtacgagcagctcgagatgctgatt
ctcaacgcgttgaccggaaggaaatga

DBGET integrated database retrieval system