KEGG   Singulisphaera acidiphila: Sinac_1591Help
Entry
Sinac_1591        CDS       T02393                                 

Definition
Mg-chelatase subunit ChlI
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
saci  Singulisphaera acidiphila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sinac_1591
Enzymes [BR:saci01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Sinac_1591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2003666..2005672
Genome map
AA seq 668 aa AA seqDB search
MTDALKKNTTTATVGDTVYPFSAIVGQEPMKLALILAAIHPGLGGVLIRGSKGAAKSTAV
RALAALLPDIDVVPDDPFRRAPGEVITEWPLPDGATFVRRPVALVNLPVGATDDRVVGSL
NFERALTTGRRTFEPGLLATAHRGLLYIDEVNLLGDHLVDVLLDAAAMGVNHVEREGLAF
RHPARFVLVGTMNPEEGDLRPQLLDRFGLAVDVEPMTDPTQRAEVVRRRLAFEADPARFR
AQWAEADRREGERIAEAQRILPSVVVPDSILEALCSRCAREGADGLRADLTIYKAATALA
AHEGRTTVTAEDIDAVAELALSHRRTTHGSPPPGSPPPPPPSGEEPPPPDRPAVPPRNDY
YAGQGRRDEPRASAESHQEDQEESEPQVIPAASPPVTPRLTPPRDRNRRAVAGRRGMVSA
PDRQGVFIRATRPKGRAHDPAIAATLGAAAPWQVSRGRDAGEPLILRAADLHDKVRARRT
QHLVLFVVDASRSMGARRRMARTKGAVLSLLIDAYQKRERVGLIVFGGTSATLALPPTRS
VRVAARHLNELPVGGLTPLAHGLLLAERTIAAVRRREPGISPLVVLLTDGRGNVPLQLGG
NPGADATVLARRFARSGVAGLVIDTEEGPVRFGLASRLARAWGAEVLSLDALGERRFPDV
VRKALFAG
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgctctgaaaaaaaacacaacaaccgccacggtcggcgacaccgtctatcct
ttctccgcgatcgtcgggcaagagcccatgaagctcgccttgatcctggcggcgatccac
cccggcctgggaggggtcctgatccgagggtcgaaaggagccgccaagagcactgcggtc
cgcgccctggcggctttgctccccgatatcgacgtggtccccgacgatcccttccgtcgc
gccccgggggaagtgatcaccgaatggccgcttcccgacggcgcaacgttcgtccgtcgg
cccgtcgcgctcgtgaacttgcccgttggcgccaccgacgaccgggtggtcggcagcctg
aactttgagcgtgccctgaccaccgggcgacgcacgttcgagcctggcctgctcgccact
gcgcaccgggggctcctttacatcgacgaggtcaacctgctcggcgatcaccttgtcgac
gtgctgctcgacgccgccgcgatgggggtcaaccacgtcgagcgcgaaggcctggcgttt
cgccaccccgcccggttcgtcctggtcggcacgatgaatcccgaggaaggcgacctccgt
ccccaactcctcgaccgcttcgggctggccgtcgacgttgagccgatgaccgacccaacg
caacgcgcggaggtggttcgccgccgcctcgcctttgaggcggaccccgcccggtttcgc
gcccaatgggccgaagccgatcgtcgtgaaggggagcgaatcgccgaggcgcaacggatc
ctaccgtcggtggtcgtccccgactcgatcctcgaggccctctgctcccgatgcgcccgc
gaaggggccgacgggcttcgcgcggacctgacgatctacaaggcggctacggccctggcc
gctcacgaaggccggacgaccgtgacagcggaagacatcgatgcggtggccgagctcgcc
ctctcccatcggcggacgactcacggatcgcctccgcccggctcacctcccccaccgccc
ccttccggtgaggagccgcccccccctgatcgccccgcggttccgccacgcaacgactat
tacgcaggccagggacgtcgcgacgagccgcgggcctcggctgagtcgcatcaggaggat
caggaggagtcggagccccaggtcatcccggcggccagtcccccggtcacgcctcggttg
acgccaccacgcgaccggaatcgtcgcgctgtggcgggacgccgagggatggtttctgcc
cccgatcgccagggcgtctttatacgtgcgacgcgcccgaaaggaagggcacacgacccc
gcgatcgccgcaacgcttggggccgctgccccttggcaggttagtcgcggacgcgacgcc
ggcgagccgctcatccttcgggcggccgacctccacgacaaagtccgcgcccgccggacc
cagcatctcgtcctcttcgtcgttgacgccagtcgctcgatgggtgcccggcgacggatg
gcccgcaccaagggggccgtgctctccctcctgatcgacgcctatcagaagcgggaacgt
gtcggcctgatcgtctttggcggtacgtccgctacgcttgccttgccgccgacgaggagc
gtccgggtggcggcccgccatctgaacgagcttcccgtgggaggtcttacgccgttggct
cacgggctcctcctggccgagcgtacgatcgcggccgtccgccgtcgcgagccggggatc
tccccgttggtcgtcctgctgaccgacggccggggcaacgttcccctccagctcggggga
aatccgggggcggatgcaaccgtgctcgctcgccgatttgcacgcagcggcgtggccggg
ctggtgatcgataccgaggaggggcccgttcggttcgggttggcctcccgactggcacgg
gcctggggcgccgaggtcctctcgctcgatgcgctcggcgagcggcgattccccgacgtc
gttcgcaaagctctattcgcggggtaa

DBGET integrated database retrieval system