KEGG   Singulisphaera acidiphila: Sinac_1777Help
Entry
Sinac_1777        CDS       T02393                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
saci  Singulisphaera acidiphila
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:saci03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2210191..2211120
Genome map
AA seq 309 aa AA seqDB search
MVMIVSSLRGKLLLGDFSEGTSHMPELPEVETMVRGLRPALGGMTLREVEVLDEFLLVGH
TAREFERLSQGAKVDRVDRRGKWVVIALGDRRGLIVIQPRMTGGFWLVPPDRPEHIRLIL
RTDGPRESIWFCDNRRLGKIAWYPSPEEAEEAFARSHGPDALEISRQELSARLERTSRGI
KPTLMDQKVLAGIGNIYADEILFRSRIHPSRPASKLSNAEIDRLHAAIPAVLAEAIAAEG
SSFDAGYRTVLGLEGGFLAGNAMYGRGGQPCPNCGDPIEKTKIAGLSGRPTHFCARCQPL
NPPRRTNKR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgattgtaagctcgcttcgcggtaaacttctgcttggtgatttctctgagggg
acaagccatatgcctgagttacccgaagtggaaacgatggtgcggggcctacggccagcg
ctcggggggatgaccctgcgcgaggtggaagtcctcgacgagttcttgctcgtcggccat
acggcccgcgagttcgagcgattgagccaaggggcgaaagtcgaccgcgtcgatcgtcgc
ggcaagtgggtcgtcatcgcgctgggtgaccgccgtggattgatcgtcatccaaccccgg
atgactggaggcttttggttggttcctcccgaccgcccggaacacatccgcctgatactc
cggacggatggaccacgggagagcatctggttctgcgacaaccgccgcctgggcaagatc
gcctggtatcccagccccgaggaggccgaggaggcgttcgcgcgatcgcacggccccgac
gcgctcgaaatcagccggcaagagctgagtgcgcggctcgaacggacgtcgcgggggatc
aagccgacgctcatggaccagaaggtgctcgctgggatcggcaacatttacgccgacgag
atccttttccggtcgcggattcacccttcgcgtcccgcctcgaagttatcgaatgcggag
atcgaccgactgcacgccgcgatcccggccgtcctggccgaggcgattgcggcggagggg
tcgagcttcgacgcggggtatcgcactgtgctcggtctcgaggggggctttttggccggc
aacgcgatgtacggccgagggggacaaccttgcccgaattgtggcgacccgatcgaaaag
acgaagatcgcgggattgagcgggcggccgacgcacttttgcgcccgctgccagcccctc
aatccacctcgtcgtaccaacaaacgttga

DBGET integrated database retrieval system