KEGG   Singulisphaera acidiphila: Sinac_2275Help
Entry
Sinac_2275        CDS       T02393                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
saci  Singulisphaera acidiphila
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sinac_2275
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sinac_2275
Enzymes [BR:saci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Sinac_2275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2798308..2799459
Genome map
AA seq 383 aa AA seqDB search
MAMVRDLVRDDVVLSARTWVVKVGTSVLTDSDGRLDPARIGHLAEQICAVMATGRKVALV
SSGAVGAGLGQLNLSRRPENLPQLQAAAAVGQSYLIRAYDEGLRRHGRHAAQLLLTHEDF
DNRARYLNMRNTLTALFDWNAVPIINENDTISVAEIKFGDNDRLAAMVTNLLQAPLLVIL
SVVDGLYPTDPGTGQIGGEPIPLVVNLDEETFGRAGTSRSTLGTGGMRSKLEAARLVTHA
GGSVIIASGQKADPLTRIMAGEAVGSLFLARGSTQTARKRWIGLTARPKGHYVVDSGARH
ALESGSRSLLAIGIVEVVGEFDKGDVVGIRDDQGQEFARGLTNYATAEARLIRGLRTEQA
RQSLEESVVYNEVVHKDNLVLIL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggtacgtgacctggttcgcgatgatgtggttctctcggcacgaacctgggtt
gtcaaggttggcaccagcgttctgacggacagcgacgggcgactcgacccggcgcgaatc
ggccacctcgccgagcagatctgcgccgtcatggcgaccggccgaaaggtggcgctggtg
agctcgggcgccgtcggagccggactgggtcaactcaacctgtcgcgccgccctgagaat
ctgccacaacttcaggctgcggcggccgtgggccagtcttacctcatccgcgcctatgat
gagggcctgcgccggcacgggcggcacgctgcgcagctcttgttgacgcacgaggatttc
gacaatcgtgcccgttacctcaacatgaggaacacgctcacagccttgtttgactggaac
gccgttccgatcatcaacgagaacgacacgatcagcgttgccgaaatcaagttcggcgat
aacgaccggcttgcggcgatggtgacgaacctgctccaggctcctttgcttgtgatcctg
agcgtggtcgacgggctctatcccaccgatccagggacgggccaaatcggcggcgagccc
attccgctcgtcgtgaatctcgatgaagagaccttcggacgcgcagggacgagccggagc
acgctcggcacgggggggatgcgcagcaagctcgaagcagcgaggttggtcacccacgcc
ggtggatcggtgatcatcgcttccggccaaaaggctgatcccctgacccggatcatggcg
ggagaagcggtggggtcgctcttcctcgcacgagggtcaacgcaaaccgctcgcaagcgc
tggatcggtttgacggcccggcccaaaggccactacgtcgtcgactccggggccaggcac
gccctggaatcgggctcgcgaagtctgctcgccattgggattgtcgaagtcgtcggtgaa
tttgacaaaggcgacgtggtgggaattcgcgacgatcagggacaggaattcgcccgagga
ttgacgaactacgcgaccgccgaggcccgcctgatccgcggcttacgcacggaacaggcc
cgtcaatcgctcgaagagtcggtcgtttataacgaggttgtccataaggacaacctcgtc
ctgattctctaa

DBGET integrated database retrieval system