KEGG   Singulisphaera acidiphila: Sinac_2350Help
Entry
Sinac_2350        CDS       T02393                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00860  Porphyrin and chlorophyll metabolism
saci01100  Metabolic pathways
saci01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sinac_2350
Enzymes [BR:saci01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Sinac_2350
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Sinac_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase DAO NAD_binding_8 NAD_binding_9 Lycopene_cycl Thi4 Pyr_redox_2 Pyr_redox FAD_binding_2 K_oxygenase HI0933_like MCRA
Motif
Other DBs
NCBI-ProteinID: AGA26662
UniProt: L0DBP2
Position
complement(2895896..2897410)
Genome map
AA seq 504 aa AA seqDB search
MGDGRRLNWDRGDFALPETSSRQDRVVVIGGGLSGLTVAHRIVERAKQARKAVEVVLLEA
KDRIGGAIWTNRGDGFTLEGGADSFITNKPWGVDLCRELGLEDQLISPDAQHRRSFVVRQ
GRLVPVPEGFVLMAPNRLGPILTTPILSVRGKLRMLMDLILPRRDRDEQGDESLASFVKR
RLGREALERLVQPLVGGIYTADPNELSLRATLPQFIAMENEHRSLILGALRQARAARSTE
RFASGARYGLFVTLADGMDTLPRTLAAALPDGTIRTSTPVRRIHRPDSISPWRVELLSGL
PIEASAVVLATEAHASARLVDGFDSDLALQLRSIPYASSVIVNVAYRRDQVAHPLDGFGA
VVPAIEGRSILAVSFLSVKFPGRAPAGKVLLRVFVGGATQPDLYECDDTRIGQIVRQELG
DLLGTFGDPLFMQVGRHPRAMPQYTLGHIDRVGAIRERLSRHPRLIMTGNAFDGVGIPDC
IRGAKAAADSAFNALADPAATAAA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggggacggccggcgtttgaattgggaccgaggggattttgctttgcctgagacttcg
tcgagacaggatcgggtggttgtgatcggcggcggcctttcggggctgaccgtggcgcac
cggatcgtggagcgcgcgaagcaggctcggaaggcggtcgaggtcgtcctcctggaagcc
aaggatcggatcggcggggcgatctggacgaaccggggcgatggtttcaccctcgaaggg
ggggcggactcgttcatcacgaacaagccgtggggggtggacctctgccgggagctcggc
ctcgaggatcagctcattagcccggacgcccagcatcgtcggtcgttcgtggtccggcag
gggcggctcgtaccggttcccgaaggcttcgtgctcatggcaccgaatcggctcgggccg
atcctcacgacaccgattctctcggtgcgcggtaagctccggatgttaatggacttgatc
ctgccccgccgcgaccgcgacgagcaaggggatgaaagtctcgcctcgttcgtgaagcga
cggctcggtcgggaggccttggagcgactggttcaaccgcttgtcggggggatttacacg
gccgatcccaatgagctgagcttgcgcgccaccctcccgcaattcattgcgatggagaac
gagcaccggagcctgattctgggggcgctccgccaggcacgagctgcgcgatcgaccgag
cgatttgcctcaggggctcgttacggcctcttcgtcaccttggccgatggcatggacacc
cttcccaggacgctggccgccgcgcttccggatggaacgattcggacgtcgactccggtg
cgccggatccaccgtcccgactcgatctcgccttggcgggtcgaattgttgagtgggctg
ccgatcgaggcgagcgccgtggttttggcgaccgaggcgcatgcgtcggcccggctcgtc
gacggcttcgattcagacctggcgctccagctccgctcgattccctacgcatcctccgtg
atcgtgaatgtggcctatcgtcgggatcaggtggcgcatccgctcgatgggttcggggcc
gtcgtccccgccatcgaaggacgatcgatcctggcggtgtcattcttgagcgtgaagttc
ccgggccgggctcccgctgggaaggtgctcctccgcgtctttgtcggaggcgcgacccaa
cctgatctctacgagtgcgacgacacccggatcggccagatcgttcgccaagaactgggc
gacttgctcggcacgtttggcgaccccctcttcatgcaggtgggtcgccatcctcgggcg
atgcctcaatacacgctcggccacatcgaccgggttggggcgattcgcgagcggctttcc
cggcacccccggctgatcatgacgggcaacgccttcgacggagtgggcattcccgactgc
attcggggggcgaaagccgccgccgattccgccttcaacgccttggccgaccccgccgcc
acggccgcggcctga

DBGET integrated database retrieval system