KEGG   Singulisphaera acidiphila: Sinac_2514Help
Entry
Sinac_2514        CDS       T02393                                 

Definition
hypothetical protein
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
saci  Singulisphaera acidiphila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sinac_2514
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinac_2514
   00030 Pentose phosphate pathway
    Sinac_2514
   00051 Fructose and mannose metabolism
    Sinac_2514
  Energy metabolism
   00680 Methane metabolism
    Sinac_2514
Enzymes [BR:saci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Sinac_2514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3119579..3121570
Genome map
AA seq 663 aa AA seqDB search
MDPQALNDNDVSGQGIRDDDLITLRALSGRFPDIDSATAEIARLAAVLTLPKGTVHVISD
VHGEDKKLRHVINNASGTLRPLVQGLFAGRMTPEEFREFLTLIFYPAEVVERLQHTLLDL
ESLRSYCTRTLRYEFELVRVLAARYSLKRAMHVFPPEYRELMAEMLHQPTTERDEAFAQA
IVDALLSRGRALHLIHLTARLVRNLAISELIIGGDCWDRGPRGDRVVDYLRQQPNVSFIW
GNHDVAWLGASFGHEALICHVLRLSLRYRRLGQLDEGYSIPLTPLEHLARTVYADDPAAG
FMPKLSGMRPDLLVARMQKAAAVMQFKLEGQVIARNPEWEMEHRRLLHHIDLAEKTIEVD
GVRYPLSDAYLPTLDPAAPYELSEDEQLCIDRLRRSFVASQKLGEHMLYLVSHGAMYLVR
DGCLIFHGCAPVDRAGEFLTMNIEGVPLAGRALFDAIGKAILRAAGHRARKDLDLLWYLW
GGERSPLFGKDRITTLERDFIADKATHHETMNPYFELIHEPWFCDRILREFNVDPKDALI
VNGHVPVRIEKGENPIKRSGKAITIDGAFSEAYGDHGYTLVLEANRILLAEHSHFESVEA
AIRDGVDIIPKVSVVRTWDRPHRIADTERGDQIRGEVRMLERLIAAYRNNELRQSGQRPW
APR
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggacccgcaggccctcaacgacaatgacgtcagtggtcagggcatccgcgacgatgat
ctgatcacgctccgcgccctctccggccggttcccggacatcgactcggccacggcggag
atcgcccgcctggccgcggtactgacgctgcccaaggggaccgtccacgtcatcagcgac
gtccacggcgaggacaagaagctccggcacgtcatcaacaacgcctccggcaccttgcgc
ccgctcgttcaggggctgttcgccgggaggatgacccccgaggagtttcgggagttcctg
acgctcattttctacccggccgaggtggtcgaacgactccaacacaccttgctcgacctc
gagtctctgcgttcgtactgcacccggaccttacggtacgagttcgagttggtccgggtc
ctcgcagcgcgttacagcctgaaacgggccatgcatgtcttcccgcctgaataccgcgaa
ctcatggcggagatgcttcaccagccaacgaccgagcgagacgaggcattcgcccaagcg
atcgtcgacgcactcctgagccgaggccgagcgctccacctgatccacctcacggcaaga
ctcgtccggaacctggcaatctccgagttgatcatcggcggcgactgctgggaccggggg
ccgaggggcgaccgcgtggtcgactacctgcgccagcagccgaatgtctcgttcatctgg
ggcaatcacgacgtcgcctggctgggggcaagcttcgggcacgaggccctgatctgtcac
gtgctccggctatcattgcggtatcggcgactgggccagctcgacgaaggatacagcatc
cccctcaccccactggagcacctggccaggacagtctatgccgacgacccggcggccgga
ttcatgcccaagttgagcggcatgcgaccggacttgctcgtcgcccggatgcagaaggcg
gccgccgtgatgcagttcaagctcgaagggcaggtgatcgcccgcaaccctgagtgggag
atggaacaccgccgcctgctccatcacatcgacctcgccgaaaagaccatcgaggttgac
ggcgtccgctatcccctaagcgacgcgtacctgccgaccttggatccggccgccccctac
gagctttccgaggacgagcaactctgtatcgaccgcctgcgccgctcgttcgtggccagc
cagaagctcggcgagcacatgctctacctcgtgagccacggggcgatgtacctcgttcgt
gacggttgcttgatcttccatggatgcgcaccggtcgaccgggccggcgagttcctcacg
atgaatatcgagggagtaccattggccgggcgcgcactcttcgacgcgattggcaaggcc
atcctccgagcggccggtcatcgggcccggaaagacctggatctgctctggtatctctgg
ggaggggaacgctcccccttgttcggtaaagaccggatcacgaccttggagcgcgacttc
atcgcggacaaggccacacaccatgagaccatgaatccctatttcgagctgattcacgag
ccctggttctgcgaccggatcctccgcgagttcaacgtcgatcccaaggacgccctgatc
gtcaacggccacgtcccagtgcgaatcgagaaaggggagaacccaatcaagcgcagtggc
aaggcgatcacgatcgacggtgccttctccgaggcgtacggcgaccacggctacactctg
gtgctagaagccaaccgaatcttgctggccgagcactcgcacttcgagtcggtggaggcc
gcaatccgtgacggcgtggacatcatccccaaagtctcggtcgtccggacctgggaccgg
ccccaccgcatcgccgacaccgagcgcggcgaccagatccgtggcgaggtcaggatgctc
gagcggctgatcgcagcttaccgcaacaatgaactgcggcagagcggccagcggccttgg
gccccccgataa

DBGET integrated database retrieval system