KEGG   Singulisphaera acidiphila: Sinac_2585Help
Entry
Sinac_2585        CDS       T02393                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
saci  Singulisphaera acidiphila
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sinac_2585
Enzymes [BR:saci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Sinac_2585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3203359..3204315
Genome map
AA seq 318 aa AA seqDB search
MARVVVLGSSNTDMTVHLPRLPTSGETLLGGSFFSGPGGKGANQAVAARRAGASVVFLSA
VGDDPLGHQALDRYRRETIDVSEVLVVPHVSSGVALIFVNDAGENMIGVAPGANVHLDVA
AVDRLPDSVFEPGSVLLAGLEVPLETVASAVRRAQRAGLRVLLNPAPADLRLLDSEILRF
VDILTPNHIEVQTLAGQPIGENPESLRSAAEAMLARGVGAVVVTNGKAGCLVLSRDAGET
TCRAIRAFPVEAVDTVGAGDAFNGALATAIAEGRPLFESAVWASAAAALAVTQPGAQTAL
APRAAIDQLAATYDNKFQ
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgtcgtcgtcctcggatccagcaacaccgacatgaccgtgcatctgccccgt
ctccccacctccggcgagacactgctggggggatcgttcttcagtgggcccggcggcaag
ggagcgaatcaagccgtcgccgcgcgtcgggccggcgcctccgtggtcttcctctcggcc
gtgggcgatgatccgctggggcaccaggcactcgaccgttaccgtcgtgaaacgatcgac
gtttccgaagtcctggtcgtgccccacgtttcgtccggcgtggcattgatcttcgtcaac
gatgcgggcgagaacatgatcggcgtcgcgcccggggccaacgtgcaccttgacgtcgcg
gccgtcgatcgcttgcccgactcagttttcgagccgggaagtgtactgctcgctggcctg
gaagttcctctggagacggtcgcaagcgccgtgcgtcgggctcaaagagcgggcctgcgt
gtgctcctcaaccccgctcccgccgacctccgtctgctcgactccgaaatactccgattc
gtggatatcctcactcccaaccacatcgaggtgcagacccttgcgggccagccgattggg
gagaatccggaaagcctccgctcggccgctgaagcgatgcttgcccgaggagttggcgcg
gtggtcgtgacaaacggtaaagcgggttgcctcgtcctgtcccgcgatgcgggggaaacg
acttgccgggcgatccgcgcttttcctgtcgaggccgttgacaccgttggagccggcgat
gccttcaatggggccctggccactgccatcgcggaaggacggcccttgttcgagtcagca
gtctgggcttctgcagccgccgccctcgcggtcactcaaccgggggcgcaaacggccctc
gccccccgcgccgccatcgatcagttggccgcaacctatgacaacaaattccaatag

DBGET integrated database retrieval system