KEGG   Singulisphaera acidiphila: Sinac_2789Help
Entry
Sinac_2789        CDS       T02393                                 

Definition
lysophospholipase L1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
saci  Singulisphaera acidiphila
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sinac_2789
Enzymes [BR:saci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sinac_2789
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Sinac_2789
Lipid biosynthesis proteins [BR:saci01004]
 Fatty acid synthase
  Component type
   Sinac_2789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3485021..3485746
Genome map
AA seq 241 aa AA seqDB search
MNRPILHPRGYLPLVAVAILSAMIGAPERAPRVLLLGDSITLGVRPGVAANQTFGGQLET
MIKARGLDASIINVGIGGERTDQALARLSEVLKANRPDIVLLMYGTNDSYVDFGRKTSRL
AIDQYRKNYGELIERIEQTGAKTVLMTPPRWADDAPPNGLGENPNLRLEPFVELVRAIAR
ERKRPLVDHYAVWSTARQNGVELMKWTTDGCHPNPDGHRAIAEEILPNLQPLLTATIPGK
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcccgattctccatccacgcggttatttgcccctcgtcgcggtggcgatcctg
tccgcgatgatcggggcccccgaacgagcgcctcgagttctcttgcttggtgactcgatc
accttgggggtacgtcccggggttgccgccaaccagaccttcggcggtcaactcgagacg
atgatcaaggctcgcggcctcgacgcctcgatcatcaacgtcggaatcggtggcgaacgg
accgaccaggcgctcgcaaggctgagcgaggttctcaaagcgaatcggcccgacatcgtc
ctcctgatgtacggcaccaacgacagctacgtcgactttggcaggaaaaccagccggctc
gcgatcgatcaatatcgcaagaactatggggaactgatcgagcgaatcgaacagaccggc
gccaaaacagtgctcatgactccgccacgttgggccgacgacgctccccccaatgggctc
ggtgagaaccccaacctccgcctcgagccattcgttgagctggtccgtgcaatcgctcgc
gagcgcaaacgtccactcgtcgatcactacgcagtctggtcgaccgcccggcaaaatggg
gtcgagctcatgaagtggaccaccgacggctgccaccccaacccggacggacatcgagcc
atcgccgaagagatcctgcccaacttacagccgctcttgaccgcaaccatccctggaaaa
gggtag

DBGET integrated database retrieval system