KEGG   Singulisphaera acidiphila: Sinac_2866Help
Entry
Sinac_2866        CDS       T02393                                 

Definition
holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
saci  Singulisphaera acidiphila
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:saci03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3596493..3597152
Genome map
AA seq 219 aa AA seqDB search
MISQIRGILRTVAEEELTLAVDPMEIEVLIPEYTRRKMQTHLGEIVSLHTIFYIEGNAMG
GRMTPRLVGFLSAIDREFFEIFCSVDGVGVRKALRAMVRPVRELARTIQDQDVKMLSTYP
GIGEATAERIVAKLRRKVGKFTLIVGQAAAVEGTAVESNGAAENVEPDVIRDTFAALLSV
GHNESEARREIDRVLTGKKKFKSVADMIDAIYQQQRQPD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgatctcgcagattcgaggcatacttcgcacggtggccgaggaagagctgacattggcg
gtggacccgatggagatcgaggtcctcatccccgagtacacacgcaggaagatgcagacg
cacctgggagaaatcgtcagtctccacaccatcttttacatcgagggaaatgcgatgggg
gggcggatgactccccgcctcgtcggcttcctctcggcgatcgaccgcgagttcttcgag
atcttctgctcggtcgacggggtcggggtccgcaaagcgcttcgggcgatggtccgcccg
gttcgcgagctcgcgcgaacgatccaggaccaggatgtcaagatgctttcaacttaccct
gggatcggcgaggcgaccgccgagcggatcgtggccaagctccgtcgcaaggtcggtaag
ttcacgctcattgtggggcaggctgcggcggtcgaagggaccgcggtcgaatccaacggc
gccgcggaaaacgtggaacctgacgtgatccgcgacacgttcgctgcgctcctctcggtc
gggcataacgagagcgaagcccggcgtgaaatcgaccgcgtcctcacgggcaagaagaag
ttcaagagtgtggccgacatgatcgacgccatctaccagcagcagcgccagcccgactaa

DBGET integrated database retrieval system