KEGG   Singulisphaera acidiphila: Sinac_2913Help
Entry
Sinac_2913        CDS       T02393                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
saci  Singulisphaera acidiphila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:saci00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3644305..3645882
Genome map
AA seq 525 aa AA seqDB search
MRLPRASGVLLHPTSLPGRYGIGDLGPEAHAFVRFLAESGQRWWQILPLGPTGFGNSPYQ
SYSSHAGNPLLINPDLLVEEGWLETNDLGEYPALPEAHIDFDAVADAKDQLLRRAFRRFS
PNQPEFTSFLQENAEWLGDYALFMALKEANGGSAWYEWEPDLVRREPSTIERWRSQLSQS
ILYYKFVQFAFARQWKALRASCAEHRIQLIGDLPIFVAQDSADVWARPDLFQLDETGRPL
FVAGVPPDYFSETGQLWGNPLYRWEAHASERFAWWISRLKSVLDRVDLVRLDHFRGFEAY
WEVPADSETAATGRWALGPGTAFLEALRDGLQGLPLIAEDLGEITAEVEALRDRFNLPGM
RVLQFAFGGDPGTELHLPHRYVNHCVAYTGTHDNETSVGWFHTSHIETTQTPEQIAAERA
FALRYLGTNGSEIHWDLIRIALASVADTVIIPLQDILGLDSSGRMNTPGIAKGNWAWRFQ
SGQLDPRVRARLADMTAVYSRWNGPLPPEFGPPHRQLVEEPMLGR
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcccgagagctagcggagttttactccatccgacctcgctgcctggccgatac
ggaatcggcgatcttggcccggaggcacacgcgttcgtccgcttcctcgccgagagcggt
cagcgctggtggcagatcctccccctgggtcccaccggcttcggcaactcgccctaccag
tcgtactcgtcacacgccggcaacccgctgctcatcaatcccgacctgctggtcgaggag
ggctggctcgaaacaaacgatctcggcgaatatcccgccttgcccgaagcccacatcgac
ttcgacgccgtggcggatgccaaagatcaacttctccgccgcgcgttccgccggttctcg
cccaaccagcctgagttcacgtcgttccttcaggagaatgccgagtggctcggcgactac
gccctcttcatggcgctgaaggaggcgaacggaggatcggcctggtatgaatgggagccc
gacctcgtcaggcgcgagccaagcacgatcgagcgatggcgcagccaactgtcccagtcg
atcctctactacaagttcgtgcagttcgccttcgcgcggcaatggaaggcgttgcgggcc
tcgtgcgcagagcaccggatccagttgattggcgacctccccatcttcgtcgcccaggac
agcgccgatgtctgggcgcggcctgacctgttccaactcgacgagacggggcgaccgctg
ttcgtggccggcgtcccccccgattatttcagcgagaccggccagctctggggcaacccg
ctctatcgctgggaggcccatgcgagcgagcggtttgcctggtggatctcccgcttgaag
tcggtgctcgaccgggtcgacctcgtgcgcctcgaccactttcggggcttcgaagcctac
tgggaggtgcccgcggattcggagacggccgcgaccggtcggtgggcgttagggccgggc
accgccttcctcgaggcgctccgtgacgggctgcaagggctccctttgatcgccgaagac
ctgggagaaatcaccgccgaggtcgaagccctccgcgaccgcttcaacctccccggaatg
cgcgtcctccagtttgccttcgggggcgatcccggcaccgagctccacctgccgcaccgc
tacgtcaaccattgcgtcgcctacacagggacccacgacaacgagacctcggtcggctgg
ttccacacgtcgcacatcgagacgacccagacgcccgaacagatcgcggccgagcgggcc
ttcgcgctccgctacctcggcaccaacggctcggaaattcactgggacctgatccgaatc
gccctggcctcggtcgccgacacagtcatcatcccgttgcaggatatcctggggctcgac
agctccgggcgcatgaacacccctggaattgccaaggggaactgggcctggcggttccag
tcgggtcagctcgacccgagggttcgcgctcgcctggccgacatgacggccgtctacagc
cgctggaacggccctctccccccggaattcggcccgccccaccggcagctcgtcgaggag
ccgatgctcggacggtga

DBGET integrated database retrieval system