KEGG   Singulisphaera acidiphila: Sinac_2932Help
Entry
Sinac_2932        CDS       T02393                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
saci  Singulisphaera acidiphila
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sinac_2932
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinac_2932
   00052 Galactose metabolism
    Sinac_2932
   00500 Starch and sucrose metabolism
    Sinac_2932
   00520 Amino sugar and nucleotide sugar metabolism
    Sinac_2932
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sinac_2932
   00524 Butirosin and neomycin biosynthesis
    Sinac_2932
Enzymes [BR:saci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sinac_2932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3678353..3679384
Genome map
AA seq 343 aa AA seqDB search
MTATAQPFLLGIEIGGTKLQLGLGRGDGQILALERRTIEPARGAAGILAQISEVVPILLS
RVEITRDQVAAGGIGFGGPVDVTRGVVTKSHQVAGWDRFPLAEWARAHLQIPLVSIQNDA
DTAGLAEARFGAGVGFSPLLYVTIGSGIGGGLILDNQIYRGSGAGALEIGHLWIVDRTTS
DLDVVKLEDVASGWAIAAAARRYAERQIADGLGEWKVLQSADGIPSRIDTAMVAEAAKAG
DQEASYILGKAVFAMAHALNQAITLLAPHRVILGGGVSLIGEEFWFAPIRNQLNLNVFPP
FRGSFDVVPAALGEDVVIHGALALARDAVANVDGSHTTETRPS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaacggcccagccctttttgctcggtattgaaatcggtggcaccaagctccag
cttggcctcgggcggggcgatggccagatcctcgctctcgagcgtcggacgatcgagccc
gcacgaggcgccgcgggaatcctcgctcagatcagtgaggtcgtgccgatcctcctgagt
cgtgtcgagatcacgcgagatcaggttgcggccggcggaatcggattcggcgggccggtc
gacgtcacccggggcgtggtgaccaagtcgcaccaggtcgcgggctgggatcggtttccc
ctggccgaatgggcccgggcgcatttgcagatcccgctcgtttcgattcagaacgacgcc
gacaccgccggactggccgaggcgagatttggcgcaggggtcggcttctctcccttgctc
tatgtcacgatcggcagtgggattggcggtggcctgatccttgataaccagatctaccgt
ggctcgggggcaggagccctcgaaatcggccacctctggattgtcgaccggacgacgtcc
gacctcgacgtcgtcaagctcgaggacgttgcctcgggctgggcgatcgcggcggcagcg
aggcgctacgcggaacggcagatcgccgatgggcttggcgaatggaaagtcctccagtcg
gccgacggcatcccctcccgaatcgacaccgcgatggtggccgaggccgcaaaggccggt
gaccaggaggcctcgtacattctggggaaggccgtcttcgcaatggctcacgcattgaat
caggccatcaccctgctcgctccccatcgggtcattctgggtggaggcgtttcgctgatc
ggcgaggagttctggttcgccccgatccgcaaccaactcaacctgaacgtcttccccccc
ttccgaggcagcttcgacgtcgttcccgccgcgttgggcgaagacgtggtgatccacggt
gccttggccttggcccgcgacgccgtggccaacgtggacggctcacacacgaccgagaca
cgtccctcgtga

DBGET integrated database retrieval system