KEGG   Singulisphaera acidiphila: Sinac_2932Help
Entry
Sinac_2932        CDS       T02393                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00010  Glycolysis / Gluconeogenesis
saci00052  Galactose metabolism
saci00500  Starch and sucrose metabolism
saci00520  Amino sugar and nucleotide sugar metabolism
saci00521  Streptomycin biosynthesis
saci01100  Metabolic pathways
saci01110  Biosynthesis of secondary metabolites
saci01120  Microbial metabolism in diverse environments
saci01130  Biosynthesis of antibiotics
saci01200  Carbon metabolism
Module
saci_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinac_2932
   00052 Galactose metabolism
    Sinac_2932
   00500 Starch and sucrose metabolism
    Sinac_2932
   00520 Amino sugar and nucleotide sugar metabolism
    Sinac_2932
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sinac_2932
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Sinac_2932
Enzymes [BR:saci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sinac_2932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AGA27218
UniProt: L0DEG7
Position
3678353..3679384
Genome map
AA seq 343 aa AA seqDB search
MTATAQPFLLGIEIGGTKLQLGLGRGDGQILALERRTIEPARGAAGILAQISEVVPILLS
RVEITRDQVAAGGIGFGGPVDVTRGVVTKSHQVAGWDRFPLAEWARAHLQIPLVSIQNDA
DTAGLAEARFGAGVGFSPLLYVTIGSGIGGGLILDNQIYRGSGAGALEIGHLWIVDRTTS
DLDVVKLEDVASGWAIAAAARRYAERQIADGLGEWKVLQSADGIPSRIDTAMVAEAAKAG
DQEASYILGKAVFAMAHALNQAITLLAPHRVILGGGVSLIGEEFWFAPIRNQLNLNVFPP
FRGSFDVVPAALGEDVVIHGALALARDAVANVDGSHTTETRPS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaacggcccagccctttttgctcggtattgaaatcggtggcaccaagctccag
cttggcctcgggcggggcgatggccagatcctcgctctcgagcgtcggacgatcgagccc
gcacgaggcgccgcgggaatcctcgctcagatcagtgaggtcgtgccgatcctcctgagt
cgtgtcgagatcacgcgagatcaggttgcggccggcggaatcggattcggcgggccggtc
gacgtcacccggggcgtggtgaccaagtcgcaccaggtcgcgggctgggatcggtttccc
ctggccgaatgggcccgggcgcatttgcagatcccgctcgtttcgattcagaacgacgcc
gacaccgccggactggccgaggcgagatttggcgcaggggtcggcttctctcccttgctc
tatgtcacgatcggcagtgggattggcggtggcctgatccttgataaccagatctaccgt
ggctcgggggcaggagccctcgaaatcggccacctctggattgtcgaccggacgacgtcc
gacctcgacgtcgtcaagctcgaggacgttgcctcgggctgggcgatcgcggcggcagcg
aggcgctacgcggaacggcagatcgccgatgggcttggcgaatggaaagtcctccagtcg
gccgacggcatcccctcccgaatcgacaccgcgatggtggccgaggccgcaaaggccggt
gaccaggaggcctcgtacattctggggaaggccgtcttcgcaatggctcacgcattgaat
caggccatcaccctgctcgctccccatcgggtcattctgggtggaggcgtttcgctgatc
ggcgaggagttctggttcgccccgatccgcaaccaactcaacctgaacgtcttccccccc
ttccgaggcagcttcgacgtcgttcccgccgcgttgggcgaagacgtggtgatccacggt
gccttggccttggcccgcgacgccgtggccaacgtggacggctcacacacgaccgagaca
cgtccctcgtga

DBGET integrated database retrieval system