KEGG   Singulisphaera acidiphila: Sinac_3004Help
Entry
Sinac_3004        CDS       T02393                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
saci  Singulisphaera acidiphila
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Sinac_3004
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sinac_3004
Enzymes [BR:saci01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Sinac_3004
Lipid biosynthesis proteins [BR:saci01004]
 Desaturase
  First
   Sinac_3004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3765807..3766763)
Genome map
AA seq 318 aa AA seqDB search
MSTTLTDPAPQKIAWAPLIWIGALHVGALLAFVPAYFTWQAVALCFFLHWVTGGLGITMT
YHRLLTHRSFATRPKALEYVLTAIGCCASEGGPIGWVSDHRRHHAHSDEEDDVHSPNRGF
GWAHMFWWMTPDITSIHTPEYYQRWAPDLCKDPVLRWLDKYFILFPILLGAGLYAIGGMP
WLVWGGFVRSVLVLHSTWLVNSATHIWGYRSHETRDKSTNLWWVAVVTYGEGWHNNHHAF
QTSARHGLRWWEVDMTYMTIRLMSYLGLAYSIKMPKIPKKTRLDNPSVLDEQAGSDPEMT
TVVSGTVSDEPELAVASK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgacgcttaccgatcccgctccgcagaagattgcctgggctcccctcatttgg
atcggggcacttcacgtgggtgccctgctcgcatttgtcccggcttacttcacctggcag
gcggttgctctttgcttcttcctgcactgggtgacgggcgggctcggcatcacgatgacg
taccaccgtcttctgacgcatcgcagcttcgcgaccaggccgaaggccctcgagtacgtc
ctgacggcgatcggctgctgtgcttcggagggcgggccgattggatgggtctccgaccat
cgccgccatcacgcccactccgacgaagaagatgacgttcacagccccaaccgaggcttc
ggctgggcgcacatgttctggtggatgacgcccgacatcacctcgatccacacgcccgag
tattaccagcggtgggctcccgatctttgcaaagatccggtccttcgttggctcgacaaa
tacttcatcctgttcccgatcctgttgggagccggcctctatgcgatcgggggcatgccc
tggctcgtctggggcggctttgttcgctcggtcctggtgctgcactcgacctggctggtc
aactcggccacccacatctggggctaccggtcgcacgaaacccgtgacaagtcgacgaac
ctctggtgggtcgccgtggtgacctacggcgaaggatggcacaacaaccaccacgccttc
cagacttcggcccgacacggcctgcgttggtgggaagtggacatgacctacatgaccatc
cgcctcatgtcgtacctcggccttgcctactccatcaagatgcccaagattcccaagaag
acgcgtctcgacaaccccagcgtgctcgacgagcaggccggtagcgatcccgagatgacg
actgtcgtctccggaacggtcagcgacgagcccgaactggccgtcgcctcgaagtaa

DBGET integrated database retrieval system