KEGG   Singulisphaera acidiphila: Sinac_3040Help
Entry
Sinac_3040        CDS       T02393                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
saci  Singulisphaera acidiphila
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sinac_3040
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sinac_3040
   00640 Propanoate metabolism
    Sinac_3040
   00660 C5-Branched dibasic acid metabolism
    Sinac_3040
Enzymes [BR:saci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sinac_3040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3808656..3809906
Genome map
AA seq 416 aa AA seqDB search
MKVHEYQAKDLLRAAGVAVPDGIVITSAEEAGAAFDQLKGGLIVVKAQVHAGGRGKGVAI
GPDDDRAKALEIASGQAPRPDGMAKGVQLVRTREEAVKAAASLLGKTLVTYQTGAEGQAI
SKVLITVGHDIVRELYLGLAFDRALQCPVLMASTEGGVEIETIAHTHPEKIHREPIDVGL
GLAGFQARKVCQVLGLKGETAKKGEVFLKNFVKLFLDTDASLAEINPLIVTDKGDVMALD
CKFNFDDNAMFRHPAIAALLDVAEEDPAELRAGKSGLSYVSLDGNIACLVNGAGLAMSTM
DLIKYHGGEPANFLDVGGGASKEQVLEGFRILLASPRVKAVLVNIFGGIMKCDIIASALL
AAYGELDFRVPLVVRLEGTNVEAGRKMIEESGRNIITAMGLTDAAEKVVAAAKGAA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttcacgagtatcaggcgaaagaccttctgcgagccgcaggggtcgcggtccct
gacgggattgtcatcacctccgccgaggaggccggcgccgcgttcgatcagttgaagggg
ggcctgatcgtcgtcaaagcccaggtccacgccggtggacgaggcaaaggggtcgccatc
ggcccggacgacgaccgcgccaaggccctcgagatcgccagcgggcaggcgcctcgcccc
gacggcatggccaagggggtgcagctcgtccgcacacgcgaagaggccgtcaaggcggcc
gccagcctgctcggcaagacgctcgtcacctatcagacgggcgcagaggggcaggccatc
tccaaggtgctgatcacagtcggccacgacatcgtccgcgagctctacctcggcctggca
ttcgaccgcgccttgcagtgccccgtgctgatggcctcgaccgaagggggcgtcgagatc
gagacgatcgcccacacgcacccggaaaagattcaccgcgagccgatcgacgtcggactc
ggcctggccggattccaggcccgcaaggtttgccaggtgctcggcctgaagggagagacc
gccaaaaagggcgaggtcttcctcaagaacttcgtcaagctcttcctggacaccgacgcc
tccctggccgaaatcaaccccttgatcgtgaccgacaagggcgacgtgatggcgctcgac
tgcaagttcaacttcgatgacaacgccatgttccggcacccggccatcgcggcgctgctc
gatgtggcggaggaagaccccgccgagctgcgtgcgggcaagagcgggctgagctacgtg
agcctcgatggcaacatcgcctgcctggtcaacggggcggggttggccatgagcacgatg
gacctgattaagtaccacgggggcgagccggccaacttcctcgacgtcggtggcggagcg
agcaaggagcaagtccttgaagggttccggatcctgctggcgtcaccacgggtcaaggcc
gtcttggtgaacatcttcggcggaatcatgaagtgcgacatcatcgcctcggccttgctg
gccgcttacggtgagctcgacttccgggtcccgctggtcgtccgcctcgaaggcacgaac
gtcgaggccggtcgaaagatgatcgaagagagtggccggaacatcatcaccgcgatgggc
ctgaccgacgccgccgagaaagtcgtcgccgctgccaaaggggccgcgtaa

DBGET integrated database retrieval system