KEGG   Singulisphaera acidiphila: Sinac_3040Help
Entry
Sinac_3040        CDS       T02393                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00020  Citrate cycle (TCA cycle)
saci00640  Propanoate metabolism
saci00660  C5-Branched dibasic acid metabolism
saci01100  Metabolic pathways
saci01110  Biosynthesis of secondary metabolites
saci01120  Microbial metabolism in diverse environments
saci01130  Biosynthesis of antibiotics
saci01200  Carbon metabolism
Module
saci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
saci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sinac_3040
   00640 Propanoate metabolism
    Sinac_3040
   00660 C5-Branched dibasic acid metabolism
    Sinac_3040
Enzymes [BR:saci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sinac_3040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AGA27323
UniProt: L0DES5
Position
3808656..3809906
Genome map
AA seq 416 aa AA seqDB search
MKVHEYQAKDLLRAAGVAVPDGIVITSAEEAGAAFDQLKGGLIVVKAQVHAGGRGKGVAI
GPDDDRAKALEIASGQAPRPDGMAKGVQLVRTREEAVKAAASLLGKTLVTYQTGAEGQAI
SKVLITVGHDIVRELYLGLAFDRALQCPVLMASTEGGVEIETIAHTHPEKIHREPIDVGL
GLAGFQARKVCQVLGLKGETAKKGEVFLKNFVKLFLDTDASLAEINPLIVTDKGDVMALD
CKFNFDDNAMFRHPAIAALLDVAEEDPAELRAGKSGLSYVSLDGNIACLVNGAGLAMSTM
DLIKYHGGEPANFLDVGGGASKEQVLEGFRILLASPRVKAVLVNIFGGIMKCDIIASALL
AAYGELDFRVPLVVRLEGTNVEAGRKMIEESGRNIITAMGLTDAAEKVVAAAKGAA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttcacgagtatcaggcgaaagaccttctgcgagccgcaggggtcgcggtccct
gacgggattgtcatcacctccgccgaggaggccggcgccgcgttcgatcagttgaagggg
ggcctgatcgtcgtcaaagcccaggtccacgccggtggacgaggcaaaggggtcgccatc
ggcccggacgacgaccgcgccaaggccctcgagatcgccagcgggcaggcgcctcgcccc
gacggcatggccaagggggtgcagctcgtccgcacacgcgaagaggccgtcaaggcggcc
gccagcctgctcggcaagacgctcgtcacctatcagacgggcgcagaggggcaggccatc
tccaaggtgctgatcacagtcggccacgacatcgtccgcgagctctacctcggcctggca
ttcgaccgcgccttgcagtgccccgtgctgatggcctcgaccgaagggggcgtcgagatc
gagacgatcgcccacacgcacccggaaaagattcaccgcgagccgatcgacgtcggactc
ggcctggccggattccaggcccgcaaggtttgccaggtgctcggcctgaagggagagacc
gccaaaaagggcgaggtcttcctcaagaacttcgtcaagctcttcctggacaccgacgcc
tccctggccgaaatcaaccccttgatcgtgaccgacaagggcgacgtgatggcgctcgac
tgcaagttcaacttcgatgacaacgccatgttccggcacccggccatcgcggcgctgctc
gatgtggcggaggaagaccccgccgagctgcgtgcgggcaagagcgggctgagctacgtg
agcctcgatggcaacatcgcctgcctggtcaacggggcggggttggccatgagcacgatg
gacctgattaagtaccacgggggcgagccggccaacttcctcgacgtcggtggcggagcg
agcaaggagcaagtccttgaagggttccggatcctgctggcgtcaccacgggtcaaggcc
gtcttggtgaacatcttcggcggaatcatgaagtgcgacatcatcgcctcggccttgctg
gccgcttacggtgagctcgacttccgggtcccgctggtcgtccgcctcgaaggcacgaac
gtcgaggccggtcgaaagatgatcgaagagagtggccggaacatcatcaccgcgatgggc
ctgaccgacgccgccgagaaagtcgtcgccgctgccaaaggggccgcgtaa

DBGET integrated database retrieval system