KEGG   Singulisphaera acidiphila: Sinac_3056Help
Entry
Sinac_3056        CDS       T02393                                 

Definition
(GenBank) Mg-chelatase subunit ChlI
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00860  Porphyrin and chlorophyll metabolism
saci01100  Metabolic pathways
saci01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sinac_3056
Enzymes [BR:saci01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Sinac_3056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 Sigma54_activat AAA_3 MCM
Motif
Other DBs
NCBI-ProteinID: AGA27337
UniProt: L0DDK4
Position
3830474..3831901
Genome map
AA seq 475 aa AA seqDB search
MATERPRTLGDLRASGYRMESVKDEMRRNLIATIQAGRPLFPDILGYEETVVPQIQNAIL
SRHDILFLGLRGQAKTRMLRQLVHLLDDAMPIIAGSEVNDHPYAPLSKEARDRVAAGGDA
TPIAWVGRDARYQEKLATPDVTIADLIGEIDMIKHAEGRYLSNELTMHFGLIPRTNRGIF
CINELPDLSPKIQVGLFNVLEERDVQIRGYPIRLTLDLCMVFSANPEDYTNRGRIVTPLK
DRIGSVVRTHYPLTRELGIAISDQNAWLDRTGGELAIPIYVKEIIEEISRLARSSSHVNQ
QSGVSVRMSIANLENVVSNSERRALLCGERWIVPRVSDLAHVATSSRGKLELTMSEDDGN
EDKLISRIVDEAVKNVFAQHLDAREFRAAVGYFESGNGIEMGDTLPAQEVLSRIEKVPHL
RKRADEFARQVQPELTDSDARDISVAAAAEFILEGLHVHNKLNKSSKAGSTSYKR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggagcggcccagaaccctgggcgatttgcgggcaagcggctatcggatggag
tcggtcaaggatgagatgaggcggaacctgatcgccacgatccaggcgggacgccccctt
ttccccgacatcctgggctacgaagagacggttgtcccccagatccagaacgccatcctg
tcacggcacgacatcctctttctcgggcttcgcggccaggccaagacgcgcatgcttcgc
cagctcgtccacctgctcgatgacgccatgccgatcatcgccgggtcggaggtcaacgac
cacccctacgctccgctctccaaagaggctcgcgaccgagtcgccgccggtggcgacgcc
acgccgatcgcctgggtcggccgtgacgcacgctatcaggagaagctcgccacccccgac
gtgacgatcgctgacctgatcggcgaaatcgacatgatcaagcacgccgaggggcgctac
ctctcgaacgaattgacgatgcacttcggcctgatcccccgtaccaaccgcgggatcttc
tgcatcaacgagctgcccgacctttcacccaagatccaggtcggcctgttcaacgtgctc
gaagagcgcgacgtccaaatccgcggctacccgattcggctcacgctcgacctctgcatg
gtcttctcggcgaaccccgaggactacaccaaccgaggccggatcgtcacaccgctgaaa
gatcggatcgggtcggtcgtccgcacccactacccgctgacgcgcgagttgggaatcgcc
atcagtgaccagaacgcctggctcgaccggaccggcggagaactggccattcccatctac
gtcaaagagattattgaagagatctcgcgactggcgcggtcgtcgtcgcacgtcaaccag
cagtcgggcgtttcggttcggatgtcgatcgccaacctcgagaacgtcgtctccaactcc
gagcgccgcgccttgctctgtggcgaacgctggatcgtgccgcgagtctccgacctggcc
cacgtggcgaccagctcgcgcggaaagctcgagctcacaatgtccgaagacgacggcaac
gaagacaagctgatcagccggattgtggacgaggcggtcaagaacgtcttcgctcagcat
ctcgacgcccgcgagttccgcgccgcggtgggctacttcgagtcgggcaacgggatcgag
atgggcgacacgcttccggcccaggaagtcctttcccggatcgagaaagtgcctcacctc
cgcaagcgggcggacgaattcgcgcgtcaggttcagcccgagctgaccgactccgacgcc
cgcgacatctcggtcgccgccgccgctgagttcatccttgaggggttgcacgtccacaac
aagctgaacaagtcgtccaaggccgggtcgacctcgtacaagcggtaa

DBGET integrated database retrieval system