KEGG   Singulisphaera acidiphila: Sinac_3199Help
Entry
Sinac_3199        CDS       T02393                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
saci  Singulisphaera acidiphila
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sinac_3199
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sinac_3199
Enzymes [BR:saci01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Sinac_3199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4011510..4013027
Genome map
AA seq 505 aa AA seqDB search
MARWFVDRLPQQGIPSVSLRRLLPEAQFVGCHDWEVSGCTADSRRLDPGQLFVAVRGVRH
DGHAFVEQALERGAAGVVVERPCPEAGRLQVIVPDSRAALAKLCQALAGDPSKHLSILGV
TGTCGRTLTSLFIRSIFEATGVRFGLIGSLGWSDGVATRSVSDTFPGAEGLASMLAAMVE
RGCAGGVVEIPALALDQRKVDGLEFDTAVVTDLSALVDTDADSLTTRRRRKARLFRKVVS
GGTAIVNADDPQAALLGAVNLDARFVTFGVDRPADVTAKIDRLDERGSRFFLRGFAREVV
VESPLIGPAQISQAMAAAAVAWSHGLPVEAVVAGLETATKVPGELEAVVEGQGFGVWIDQ
ARNGAELEQALGALRAIGAQRIHCVFGAEGLHERSERLGLAKAAEAGADRVTLTTDNPRT
EDVDQIIDDLLAGFHRPGRVRVELDRRSAIEATLADAQPGDAVLIAGKGVRTFQILADRA
LHFDDKAVATEWLRSRHQLPRRTSA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcacgctggtttgtggaccgtttgccgcagcaagggattccatcggtcagcctgcga
cgactcctgcccgaggcccagttcgtgggatgccacgactgggaagtttccgggtgtacg
gcagacagtcgccggcttgacccagggcagttgttcgtcgcggtgcggggagtccggcac
gatgggcacgcgttcgtcgagcaggcactcgagcggggcgcggcgggggtggtggtcgaa
cgaccttgcccggaagcaggccgactccaggtgatcgttcccgactcccgcgcggcactg
gccaagctctgccaggccctggcgggcgacccatccaaacatctctcaatcctcggcgtg
accggaacctgcggccgcacgctgacgagcctgttcatccggtcgatcttcgaggcgacc
ggcgtccgatttgggctcatcggttcgctgggctggtccgacggcgtggcgacccgttcg
gtctccgatacctttccgggggccgaaggcctggcctcgatgctcgccgcgatggtcgag
cgcggctgtgcggggggggtcgtagaaatccccgcgctcgcactcgatcagcgcaaggtc
gacggcctggagttcgacaccgccgtggtgacggacctgagcgcacttgttgataccgac
gccgacagcctcacgacgcgacgccggcgcaaggcacgcctgttccgcaaagtcgtgagt
gggggaacggcgatcgtcaacgcggatgatccccaggccgcactcctgggagccgtcaat
ctcgacgcgcgcttcgtcaccttcggagtcgatcgtccggccgacgtcaccgcgaaaatc
gaccggctcgacgagcgtgggtcgcggttcttcctacgtggcttcgctcgcgaggtggtc
gtcgagtcgccattgatcggccccgcacagatttctcaggcgatggccgcagccgccgtg
gcctggtcccacggcctcccggtcgaagccgttgtggcgggtctggagacagccacgaaa
gttcctggggaactcgaggccgtggttgaagggcaaggcttcggcgtctggatcgatcaa
gcgcggaacggggccgagctcgagcaggcgctcggtgcgctccgagctatcggtgcccag
cgaattcactgcgtcttcggcgcagagggccttcacgagcgcagcgagcgactcggcctg
gccaaagcggccgaagcaggggccgaccgcgtgaccctgacgaccgataacccacggacc
gaagacgtcgaccagatcatcgacgacctactcgccggcttccaccgtcccggccgcgtc
cgggtcgagcttgatcgtcgttccgccattgaggcgacgctcgccgacgcccaaccgggc
gatgccgtcttgatcgccggcaaaggcgtgcgaacctttcagatcctcgccgatcgtgcc
ctccacttcgacgacaaagcggtcgccacggaatggctccgctcacgccaccaactcccc
cgccgaacctccgcctga

DBGET integrated database retrieval system