KEGG   Singulisphaera acidiphila: Sinac_3576Help
Entry
Sinac_3576        CDS       T02393                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
saci  Singulisphaera acidiphila
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:saci00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:saci00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4474061..4474639
Genome map
AA seq 192 aa AA seqDB search
MIVSAIAAMSRTGVIGDGVKMPWHLPRDLRRFRDSTMGKPVIMGRRTLESLRGPLPGRLN
IALTHSASYRAEGFRIARSIDDAIRIAEEQGGDHGEVMVIGGGVVYQDTAPLWDRLLLTV
VEGEFPGGTYFPLAMAKEERWRLVRQEYCAPDSKNAHAHWFLSLERENASHLEAQRFDLS
TWLNTQPAPIAG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtctctgccattgccgcgatgagtcgtacgggagtgatcggcgatggcgtcaaa
atgccctggcacctcccgcgcgacttgagacgattccgcgactccaccatgggcaagccg
gtcatcatggggcgccggaccttggaatcccttcgcggcccgctgcccggtcgactcaac
atcgccctcacgcattcggccagctaccgcgcggagggatttcgaatcgcgagatccatc
gacgacgcgatccggattgccgaagagcaggggggtgaccacggcgaagtcatggtcatc
ggcgggggggtggtctaccaagacacggctcccctctgggatcggctcctgctcaccgtc
gtggaaggcgaatttccgggcggcacgtatttcccattagcgatggcgaaggaagagcgg
tggcggctggtcagacaggagtactgcgctcctgacagcaagaatgcacacgcccattgg
ttcctcagcctcgagcgcgagaacgcgtcccacctcgaggctcaacgcttcgacctctcc
acgtggctcaacactcagcccgccccaatcgcaggttga

DBGET integrated database retrieval system