KEGG   Singulisphaera acidiphila: Sinac_3685Help
Entry
Sinac_3685        CDS       T02393                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
saci  Singulisphaera acidiphila
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:saci00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sinac_3685
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sinac_3685
Enzymes [BR:saci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sinac_3685
Two-component system [BR:saci02022]
 CheA family
  CheA-CheYBV
   Sinac_3685
Bacterial motility proteins [BR:saci02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sinac_3685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4618331..4619434)
Genome map
AA seq 367 aa AA seqDB search
MNSGLVEHLTGRNRTRAMRKIRVLIIGGSFVVRRMLAEAIAADPALEVLGIAAGARLGLA
KIEQGRPDLVVLGGETSKGDGSGILAAIQRAHPRLSIILFGEEKERRLDRSAANSRALDP
GRLAVAIHGIPGGLIATIKRHGVSDEEAKAPRNLGAAIEKVEILVIGASTGGPDALALLL
SSFRADFPVPILIVQHLPPNFTRYLVDRLAHHSALGVQEAAPGDRLLPGHAWLAPGNVHL
VVARDSQGVCVRFSHDPPEQSCRPSVDVLFRSVAAVYGPAALAVVLTGMGRDGLAGCAAI
RAAGGQVLVQDEATSVVWGMPGQVSRAGLADLVLPLGALGPEIDRRSRERWPARRRFEGE
SEEAPCR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgggacttgtggaacacctgactgggcggaaccggacccgagccatgcgaaag
atccgcgtcctcatcatcggcggttccttcgtcgttcgtcggatgctggccgaagccatc
gcggctgatcctgcgctggaggtcctcggcattgctgcgggcgctcgtctcgggctggcg
aaaatcgagcaaggtcgcccggacctggtcgttctcgggggggagacgtcgaagggggac
ggctccgggatcctcgcggcgatccagcgggcgcacccgcgcctttccatcatcctgttc
ggcgaggagaaggagcggcgacttgatcgttcggccgccaattcaagggcgttggatccc
gggcgattggcggtcgcgatccacgggattcccggcggcctgatcgccacgatcaagcgc
catggcgtcagcgatgaagaggcgaaggctccccggaacctcggcgctgcaattgagaag
gttgagatcttggtcattggtgcgtcgactggcggtccggatgccctggctctgctcttg
tcgtcgttccgggccgatttcccggtcccgatcctgatcgtgcagcatctgcctccgaac
ttcacgagatatctcgtcgaccgcctggcgcatcattcggcgttgggtgtgcaagaggcc
gcgcctggcgatcgactcctccccggccatgcctggttggcccctgggaacgttcacctg
gtggttgcgagggattcgcagggggtctgtgtacggtttagccacgatccgccggagcaa
tcgtgccggccgtcggtggacgtcttgttccgctcggtggcggccgtctatgggccggcc
gcgctggccgtcgttctgaccggcatggggcgggatggcctggccggatgcgcggcgatc
cgcgcggccggcggccaggtcctcgttcaagatgaggcgaccagcgtcgtctgggggatg
cccggccaggtctcccgcgccgggctggccgacctggtcctgccgctcggcgctcttggc
ccggagatcgaccggcggtcgcgcgagcgatggcccgctcgccgaaggttcgagggagaa
tccgaggaggcaccatgccgttga

DBGET integrated database retrieval system