KEGG   Singulisphaera acidiphila: Sinac_3701Help
Entry
Sinac_3701        CDS       T02393                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
saci  Singulisphaera acidiphila
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sinac_3701
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinac_3701
Enzymes [BR:saci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sinac_3701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4634873..4635703
Genome map
AA seq 276 aa AA seqDB search
MAETILDEIVASKRREVAAARLRMPLQEMEDQAASAPPVRDFRAALAGPGPIQLIAEVKK
ASPSAKVIRADFDPIAIARAYQGHGAACLSVLTDVPYFQGHLSYLARIRASVAIPLLRKD
FIIDEYQVVEARLAGADAILLIAEILDDETLARLLARARGLGMAALVEFHEEANLPRVLA
SGADLVGINNRDLRRFVTDLDLTLRLRPQIPPDVLLVSESGIRTHADVKRLEAAGVSAIL
VGESLMRADDIGLAVEQLLGLAPETKPAQDPVTPAG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtggcggaaaccatcctcgacgaaatcgtcgcgtccaagcggcgcgaggtcgcagcggcc
cggctccggatgcctctccaggagatggaggaccaggccgcctcagcgccgccggtccgc
gatttccgcgcggcgctggccggacccggaccgatccaactgatcgccgaggtcaaaaag
gcgagcccgtcggccaaggtcatccgggccgacttcgacccgatcgccatcgcacgcgcc
taccagggccatggggcggcctgtctcagcgtcctgactgacgtcccctacttccaggga
cacctctcctacctggcccggatccgcgcgtcggtcgcgatcccgttgctccgcaaggat
ttcatcatcgacgagtatcaggtcgtcgaggccaggctcgccggggccgacgcgatcctc
ttgatcgccgagatcctcgacgacgagacgttggcccgactgctcgccagggctcgaggc
ctgggcatggccgccctggtcgagttccacgaagaggccaacctcccccgcgtcctcgct
tcgggggccgacctggtcgggatcaacaaccgcgacctccgccggttcgtcaccgacctc
gacctgaccttgcgcctccgcccccagatcccccccgacgtgctcctggtcagcgagagc
gggatcaggactcacgcggacgtcaagcgcctcgaggccgccggggtctcggccatcctc
gtcggcgagtccttgatgagggccgacgacatcggcctggccgtcgagcagctcctcggg
ctcgcccccgagacgaagcccgcgcaggatccggtgaccccggcgggctga

DBGET integrated database retrieval system