KEGG   Singulisphaera acidiphila: Sinac_3701Help
Entry
Sinac_3701        CDS       T02393                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00400  Phenylalanine, tyrosine and tryptophan biosynthesis
saci01100  Metabolic pathways
saci01110  Biosynthesis of secondary metabolites
saci01130  Biosynthesis of antibiotics
saci01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinac_3701
Enzymes [BR:saci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sinac_3701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PEP_mutase FMN_dh QRPTase_C His_biosynth
Motif
Other DBs
NCBI-ProteinID: AGA27943
UniProt: L0DGL3
Position
4634873..4635703
Genome map
AA seq 276 aa AA seqDB search
MAETILDEIVASKRREVAAARLRMPLQEMEDQAASAPPVRDFRAALAGPGPIQLIAEVKK
ASPSAKVIRADFDPIAIARAYQGHGAACLSVLTDVPYFQGHLSYLARIRASVAIPLLRKD
FIIDEYQVVEARLAGADAILLIAEILDDETLARLLARARGLGMAALVEFHEEANLPRVLA
SGADLVGINNRDLRRFVTDLDLTLRLRPQIPPDVLLVSESGIRTHADVKRLEAAGVSAIL
VGESLMRADDIGLAVEQLLGLAPETKPAQDPVTPAG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtggcggaaaccatcctcgacgaaatcgtcgcgtccaagcggcgcgaggtcgcagcggcc
cggctccggatgcctctccaggagatggaggaccaggccgcctcagcgccgccggtccgc
gatttccgcgcggcgctggccggacccggaccgatccaactgatcgccgaggtcaaaaag
gcgagcccgtcggccaaggtcatccgggccgacttcgacccgatcgccatcgcacgcgcc
taccagggccatggggcggcctgtctcagcgtcctgactgacgtcccctacttccaggga
cacctctcctacctggcccggatccgcgcgtcggtcgcgatcccgttgctccgcaaggat
ttcatcatcgacgagtatcaggtcgtcgaggccaggctcgccggggccgacgcgatcctc
ttgatcgccgagatcctcgacgacgagacgttggcccgactgctcgccagggctcgaggc
ctgggcatggccgccctggtcgagttccacgaagaggccaacctcccccgcgtcctcgct
tcgggggccgacctggtcgggatcaacaaccgcgacctccgccggttcgtcaccgacctc
gacctgaccttgcgcctccgcccccagatcccccccgacgtgctcctggtcagcgagagc
gggatcaggactcacgcggacgtcaagcgcctcgaggccgccggggtctcggccatcctc
gtcggcgagtccttgatgagggccgacgacatcggcctggccgtcgagcagctcctcggg
ctcgcccccgagacgaagcccgcgcaggatccggtgaccccggcgggctga

DBGET integrated database retrieval system