KEGG   Singulisphaera acidiphila: Sinac_4136Help
Entry
Sinac_4136        CDS       T02393                                 

Definition
agmatinase
Orthology
K18459  
guanidinopropionase [EC:3.5.3.17]
Organism
saci  Singulisphaera acidiphila
Brite
Enzymes [BR:saci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     Sinac_4136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5158215..5159231)
Genome map
AA seq 338 aa AA seqDB search
MTEPDLSPLFERIAGYGRHMLDMPFSGPTSFFRTDVVDTLEGVDIALIGVPTDAGLSHRP
GARYGPQAVRAQSGLIRYINPYTGVIPYEHGRVVDAGDVPFQNTLVLDDIVREIFSYYTQ
VVAAGVVPLSVGGDHSITYPILKAVASRGPVGLIHFDSHHDTAPPMKGSRFHHGAPFRNA
VEDGLIDPRRTVQIAIRDPYRQAARPYAEAHGFTVLDMPLILREGLDAVVATTRKTIGDG
PVYITFDVDALDPAFAPGTGTPVVGGLSSREAMILLQGLRGLNIVGADVVEVSPPYDPTG
MTALAGAQILMELLCLASESLAKKGNQSARAIFDRGDH
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagccggatctctcgccacttttcgaacggatcgctgggtacgggcggcacatg
ctcgacatgccgttctcgggtccgacgtcgttcttccggacggacgtggtcgacaccctc
gagggcgtcgatatcgcattgatcggggtaccaaccgatgccggcctgagccatcggccg
ggcgcgagatatggtccgcaagctgttcgggctcagtcgggcctgatccgttacatcaat
ccttacacgggcgtgatcccgtatgagcacggccgagtagtggatgccggcgatgtcccg
tttcagaatacgcttgtgctcgacgacatcgtccgggagattttcagctactacacgcag
gtggtcgccgcgggggtcgtcccgctctcggtgggcggcgatcactcgatcacctatccg
attctgaaagccgtggcgagtcgtggcccggtcgggctcattcatttcgactcgcaccac
gacaccgctcctcccatgaaaggctcgcgatttcatcacggggcgccgtttcggaacgcc
gttgaagacgggctgatcgatccgcgccggaccgtccagatcgcgattcgggatccgtac
cgtcaagccgcgcgtccttacgcggaagcacatggttttaccgtgctcgatatgcctctg
atcctccgcgaaggccttgatgccgtggtcgcgaccacccgcaagacgatcggagacggg
ccggtttatatcacattcgacgtcgacgcgctcgaccctgcctttgccccggggaccggc
acgcctgttgttggcggactcagttcgcgtgaggccatgattctgctccaagggttgcgg
gggctcaacatcgtcggcgcggacgtcgtcgaggtctctcccccgtacgacccgaccggc
atgacggcgctggccggagcccagattcttatggaacttctctgcctcgcttccgagtcg
ctcgcaaagaaagggaatcaatcagcgagagcgattttcgatcggggggatcactga

DBGET integrated database retrieval system