KEGG   Singulisphaera acidiphila: Sinac_4339Help
Entry
Sinac_4339        CDS       T02393                                 

Definition
arginase family hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
saci  Singulisphaera acidiphila
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:saci00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5383308..5384609)
Genome map
AA seq 433 aa AA seqDB search
MSGSDSSGEMKRRDFLGAAAAAAALGGLETTTASGQETKAGADPKVNAAQLYKRHAPNRR
QHDRPLPDLSQYSGMQAQKAEGALPSAYHEKEMRRIKELGLEPADSIQDKSDISCFQRGS
SPHWSGINTFLKLPYVEDVHKVGEYDVAFVGVPFDVGCTFRTGTRFGPQGMRRISALYQK
YSFEHGIDLGETLAMCDVGDIFCPANITKSHDQITKGIAHILSQGTLPMIMGGDHSIGYP
IARAVAQCVEGKVGIIHLDRHVDTQEKDMDEIMHTCPWFHATNIPNCPPSNLVQLGIGGW
QVPRAGVKVGRDRGTTILTVNDIEQIGIDKTIEIALEVAWKGASAVYLSFDIDSLDAGFV
PGTGWPEPGGLLPREALKIINGIAKEGIAAMEVCEVSPPYDISDITSLMGVRLMMDVLGT
MAKNGRIGGRLKV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatcggattcgtctggcgagatgaaacggcgcgatttcctgggagcggccgcg
gccgcggcggccctggggggcctggagacgaccacggcctcggggcaggaaacgaaggcc
ggcgcggaccccaaggtcaatgcggcccaactctacaagcggcacgcaccgaatcgccga
caacatgatcgcccgctccctgatctgagccaatactccggcatgcaggcccagaaggcc
gagggcgcattgccctcggcctatcacgagaaggagatgcgtcggatcaaggaactgggc
ctggagccggccgattcgatccaggacaagtccgacatcagttgcttccagcgaggaagc
tcgccgcactggtcgggcatcaacaccttcctgaagttgccttacgtcgaggacgtccac
aaggtgggcgaatatgacgttgcgtttgtgggagtgccgttcgacgtcggctgcacattc
cgcacgggcaccaggttcgggccgcaagggatgcggcgcatctcggcgctctaccagaaa
tacagcttcgagcacgggatcgacctgggcgagacgctcgcgatgtgcgacgtcggcgac
atcttctgcccggccaacatcaccaagagccacgaccagatcaccaaggggatcgcgcac
atcctgtcgcagggcacgttgccgatgatcatgggcggcgaccactcgatcggctatccc
atcgcccgcgcggtcgcgcaatgcgtggaggggaaggtagggatcatccacctcgaccgc
cacgtggacacgcaggaaaaggacatggatgagattatgcatacctgtccttggttccac
gccaccaatattccgaattgcccgccgtcgaacctggtgcagttggggatcggaggctgg
caggtgccccgcgccggcgtgaaggtggggcgggaccgcggcacgaccatcctgaccgtc
aacgacatcgagcagatcgggatcgacaagaccatcgagattgctttggaagtcgcgtgg
aagggggcgagtgccgtctacctgtcgttcgacatcgactcgctggacgccggattcgtc
cctgggacgggctggccggagccgggcggactcctcccccgggaggcgctcaagatcatc
aacggcatcgcgaaggaagggatcgccgccatggaggtctgcgaggtgtcgccgccgtac
gacatctcggacatcacgtcgctgatgggcgtccggctcatgatggacgtactgggcacg
atggccaagaacggccgcatcggcggccggctgaaggtctga

DBGET integrated database retrieval system