KEGG   Singulisphaera acidiphila: Sinac_4339Help
Entry
Sinac_4339        CDS       T02393                                 

Definition
(GenBank) arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00330  Arginine and proline metabolism
saci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sinac_4339
Enzymes [BR:saci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Sinac_4339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase TAT_signal UCR_Fe-S_N
Motif
Other DBs
NCBI-ProteinID: AGA28536
UniProt: L0DIQ7
Position
complement(5383308..5384609)
Genome map
AA seq 433 aa AA seqDB search
MSGSDSSGEMKRRDFLGAAAAAAALGGLETTTASGQETKAGADPKVNAAQLYKRHAPNRR
QHDRPLPDLSQYSGMQAQKAEGALPSAYHEKEMRRIKELGLEPADSIQDKSDISCFQRGS
SPHWSGINTFLKLPYVEDVHKVGEYDVAFVGVPFDVGCTFRTGTRFGPQGMRRISALYQK
YSFEHGIDLGETLAMCDVGDIFCPANITKSHDQITKGIAHILSQGTLPMIMGGDHSIGYP
IARAVAQCVEGKVGIIHLDRHVDTQEKDMDEIMHTCPWFHATNIPNCPPSNLVQLGIGGW
QVPRAGVKVGRDRGTTILTVNDIEQIGIDKTIEIALEVAWKGASAVYLSFDIDSLDAGFV
PGTGWPEPGGLLPREALKIINGIAKEGIAAMEVCEVSPPYDISDITSLMGVRLMMDVLGT
MAKNGRIGGRLKV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatcggattcgtctggcgagatgaaacggcgcgatttcctgggagcggccgcg
gccgcggcggccctggggggcctggagacgaccacggcctcggggcaggaaacgaaggcc
ggcgcggaccccaaggtcaatgcggcccaactctacaagcggcacgcaccgaatcgccga
caacatgatcgcccgctccctgatctgagccaatactccggcatgcaggcccagaaggcc
gagggcgcattgccctcggcctatcacgagaaggagatgcgtcggatcaaggaactgggc
ctggagccggccgattcgatccaggacaagtccgacatcagttgcttccagcgaggaagc
tcgccgcactggtcgggcatcaacaccttcctgaagttgccttacgtcgaggacgtccac
aaggtgggcgaatatgacgttgcgtttgtgggagtgccgttcgacgtcggctgcacattc
cgcacgggcaccaggttcgggccgcaagggatgcggcgcatctcggcgctctaccagaaa
tacagcttcgagcacgggatcgacctgggcgagacgctcgcgatgtgcgacgtcggcgac
atcttctgcccggccaacatcaccaagagccacgaccagatcaccaaggggatcgcgcac
atcctgtcgcagggcacgttgccgatgatcatgggcggcgaccactcgatcggctatccc
atcgcccgcgcggtcgcgcaatgcgtggaggggaaggtagggatcatccacctcgaccgc
cacgtggacacgcaggaaaaggacatggatgagattatgcatacctgtccttggttccac
gccaccaatattccgaattgcccgccgtcgaacctggtgcagttggggatcggaggctgg
caggtgccccgcgccggcgtgaaggtggggcgggaccgcggcacgaccatcctgaccgtc
aacgacatcgagcagatcgggatcgacaagaccatcgagattgctttggaagtcgcgtgg
aagggggcgagtgccgtctacctgtcgttcgacatcgactcgctggacgccggattcgtc
cctgggacgggctggccggagccgggcggactcctcccccgggaggcgctcaagatcatc
aacggcatcgcgaaggaagggatcgccgccatggaggtctgcgaggtgtcgccgccgtac
gacatctcggacatcacgtcgctgatgggcgtccggctcatgatggacgtactgggcacg
atggccaagaacggccgcatcggcggccggctgaaggtctga

DBGET integrated database retrieval system