KEGG   Singulisphaera acidiphila: Sinac_4828Help
Entry
Sinac_4828        CDS       T02393                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
saci  Singulisphaera acidiphila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:saci01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:saci00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:saci00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6012271..6013722
Genome map
AA seq 483 aa AA seqDB search
MSVPTTMTQTDLAYQQCINPACRATYAVDQTIFACPTCGDLLDVVYDWDRLPVPSRLNEF
EAKWSTRLDPLNFSGVWRFRELLPFAPREMVVTVGEGQTLLQSADKVAQYVGMTPGNLKL
QYEGMNPSGSFKDNGMTAAFTHARMVGARRVACASTGNTSAALAVYCSATDFGFKAIIFI
GSGKIAYGKLAQALDHGALTIQIVGDFDDAMHRVRQVADRLGIYLMNSVNPFRLEGQKTI
MYRVLEGLGWEVPDWIVVPGGNLGNSSAFGKAFIELKHLGLIDRVPRLAVINAAGARTLE
YLVSEHNLTWRDGLPDMAASQTYYDELDAKHLKASTIASAIEINRPVNLKKCLRALDFCQ
GVVRQVSDQEIMDAKARVGSGGLGCEPASAASVAGAKKLREEGIIAPSDRVVCILTGHQL
KDPTATVAYHGTDQENFEKVLGSRGVHRAGFANRPVVVPNDLDDIIRTIALYSDAGSAGE
AGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgcccaccaccatgacgcagaccgacctggcttatcaacagtgcatcaacccg
gcctgccgggcgacttatgcggttgaccagacgattttcgcctgcccgacgtgcggcgac
ttgctcgacgtcgtttacgattgggaccggcttccggtcccgagccggctgaacgagttc
gaggccaagtggtcgacccggctcgacccgctcaacttctcgggggtctggcggttccgc
gaattgcttccgtttgcgccgcgcgagatggtggtgaccgtcggcgaagggcagacgctg
cttcagtcggccgacaaggtcgctcagtacgtcgggatgacacccggcaacttgaagcta
cagtacgaggggatgaacccctccggaagcttcaaagacaacggcatgaccgcagccttc
acccatgcccggatggtcggtgcccgccgcgtggcctgcgcgtcgacgggcaacacctcg
gcggccctggcggtctactgctcggcgaccgacttcggcttcaaggcgatcatcttcatc
ggctcgggcaagatcgcctacggcaagctcgcgcaagccctcgatcacggtgccttgacc
atccagatcgtcggcgacttcgacgatgcgatgcaccgcgtccggcaggttgccgaccgg
ctgggcatctacctgatgaactcggtcaacccgttccgcctcgaaggtcagaagacgatc
atgtaccgggtcctcgaggggctcggttgggaagttcccgactggatcgtcgttcccggg
ggcaacctcggcaactcgagtgccttcggcaaggcgttcatcgagctgaagcacctgggc
ctgatcgaccgcgttccgcgcctggccgtaatcaacgcggcaggggcccggaccctggag
tacctggtcagcgagcataacctgacctggcgcgacggcctccccgacatggcggcgagc
cagacctattatgacgagctcgacgccaagcacttgaaggcgtcgacgattgcctcggcc
attgagatcaatcgcccggtcaacctcaagaagtgcttgcgggcgctcgacttctgccag
ggggtcgttcgccaggtgagcgaccaggagatcatggacgccaaggcacgggtcggctcg
gggggcctcgggtgcgagcctgccagcgccgcgagtgtggcgggggccaagaagctccgc
gaggaggggatcatcgccccgtccgaccgggtcgtctgcatcctcaccggtcaccagctc
aaggacccgacggcgacggtcgcctaccatggcaccgaccaagagaacttcgagaaggtg
ctgggcagccgaggcgtccaccgcgccgggtttgccaatcgcccggttgtggttcccaac
gacctcgacgatatcatccggacgatcgcgctctactccgatgcagggtcggccggcgaa
gccggggcgtag

DBGET integrated database retrieval system