KEGG   Singulisphaera acidiphila: Sinac_4828Help
Entry
Sinac_4828        CDS       T02393                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00260  Glycine, serine and threonine metabolism
saci00750  Vitamin B6 metabolism
saci01100  Metabolic pathways
saci01110  Biosynthesis of secondary metabolites
saci01120  Microbial metabolism in diverse environments
saci01230  Biosynthesis of amino acids
Module
saci_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sinac_4828
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sinac_4828
Enzymes [BR:saci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sinac_4828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AGA28987
UniProt: L0DIA3
Position
6012271..6013722
Genome map
AA seq 483 aa AA seqDB search
MSVPTTMTQTDLAYQQCINPACRATYAVDQTIFACPTCGDLLDVVYDWDRLPVPSRLNEF
EAKWSTRLDPLNFSGVWRFRELLPFAPREMVVTVGEGQTLLQSADKVAQYVGMTPGNLKL
QYEGMNPSGSFKDNGMTAAFTHARMVGARRVACASTGNTSAALAVYCSATDFGFKAIIFI
GSGKIAYGKLAQALDHGALTIQIVGDFDDAMHRVRQVADRLGIYLMNSVNPFRLEGQKTI
MYRVLEGLGWEVPDWIVVPGGNLGNSSAFGKAFIELKHLGLIDRVPRLAVINAAGARTLE
YLVSEHNLTWRDGLPDMAASQTYYDELDAKHLKASTIASAIEINRPVNLKKCLRALDFCQ
GVVRQVSDQEIMDAKARVGSGGLGCEPASAASVAGAKKLREEGIIAPSDRVVCILTGHQL
KDPTATVAYHGTDQENFEKVLGSRGVHRAGFANRPVVVPNDLDDIIRTIALYSDAGSAGE
AGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgcccaccaccatgacgcagaccgacctggcttatcaacagtgcatcaacccg
gcctgccgggcgacttatgcggttgaccagacgattttcgcctgcccgacgtgcggcgac
ttgctcgacgtcgtttacgattgggaccggcttccggtcccgagccggctgaacgagttc
gaggccaagtggtcgacccggctcgacccgctcaacttctcgggggtctggcggttccgc
gaattgcttccgtttgcgccgcgcgagatggtggtgaccgtcggcgaagggcagacgctg
cttcagtcggccgacaaggtcgctcagtacgtcgggatgacacccggcaacttgaagcta
cagtacgaggggatgaacccctccggaagcttcaaagacaacggcatgaccgcagccttc
acccatgcccggatggtcggtgcccgccgcgtggcctgcgcgtcgacgggcaacacctcg
gcggccctggcggtctactgctcggcgaccgacttcggcttcaaggcgatcatcttcatc
ggctcgggcaagatcgcctacggcaagctcgcgcaagccctcgatcacggtgccttgacc
atccagatcgtcggcgacttcgacgatgcgatgcaccgcgtccggcaggttgccgaccgg
ctgggcatctacctgatgaactcggtcaacccgttccgcctcgaaggtcagaagacgatc
atgtaccgggtcctcgaggggctcggttgggaagttcccgactggatcgtcgttcccggg
ggcaacctcggcaactcgagtgccttcggcaaggcgttcatcgagctgaagcacctgggc
ctgatcgaccgcgttccgcgcctggccgtaatcaacgcggcaggggcccggaccctggag
tacctggtcagcgagcataacctgacctggcgcgacggcctccccgacatggcggcgagc
cagacctattatgacgagctcgacgccaagcacttgaaggcgtcgacgattgcctcggcc
attgagatcaatcgcccggtcaacctcaagaagtgcttgcgggcgctcgacttctgccag
ggggtcgttcgccaggtgagcgaccaggagatcatggacgccaaggcacgggtcggctcg
gggggcctcgggtgcgagcctgccagcgccgcgagtgtggcgggggccaagaagctccgc
gaggaggggatcatcgccccgtccgaccgggtcgtctgcatcctcaccggtcaccagctc
aaggacccgacggcgacggtcgcctaccatggcaccgaccaagagaacttcgagaaggtg
ctgggcagccgaggcgtccaccgcgccgggtttgccaatcgcccggttgtggttcccaac
gacctcgacgatatcatccggacgatcgcgctctactccgatgcagggtcggccggcgaa
gccggggcgtag

DBGET integrated database retrieval system