KEGG   Singulisphaera acidiphila: Sinac_5068Help
Entry
Sinac_5068        CDS       T02393                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
saci  Singulisphaera acidiphila
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6332608..6334047
Genome map
AA seq 479 aa AA seqDB search
MLARFGSVTRLALAAALLTLGGCGGTGTEKEEAASAPSPSGALDAAAAKATDTNSADLPA
KLVTPDRAVDPKKLVDVVEQEVKGGENASPSPESILWLPTDQAKVKDEPLTVQVPKGLSP
LILNVNVPASNPLTKAKFELGKQLYFDPRVSLDGTISCATCHNPEKGWTDQLKFSIGIDG
QTGGRNAPTVVNTVYGKTMFWDGRAPSLEGQAQGPIQNPIEMGKQSYEDIVKRLRTIPSY
KEQFATVFGSDVTLDGMAKAIATFERVAALSGNSRYDKYNSGDDLAALSESEKRGMVLFG
LRLRSEDEFKPNVTLKKADCTSCHTGSNFTNEQFHNIGVGWNTEKNDFADYGRFVISPIG
SKNNAELGAFKTPTVREIEKTGPYMHDGSMKTLEEVVEHYNKGGNPNPALDKDIKKLNLT
DSEKADVVAFLKALTGEEIKVALPTLPPGADGKTPDPQAALTPPPLKTVSNVFHPDVQQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgttggcaagattcggatcggtcacgcggttggcactggctgcggccttgctcacgttg
ggaggttgtggtggaacgggcaccgagaaggaggaggcagcctcggccccttcacccagc
ggagcgctggatgcagcggcggcgaaggccaccgacacgaactcggccgatctgccggcc
aagcttgtcacgcccgatcgtgcggtcgaccccaaaaagctcgtcgatgttgtggaacag
gaagtgaaggggggagagaatgcctctccgagtcccgagagcatcctctggctgccgacc
gatcaggcgaaggtcaaggatgagccgctcacggtccaggttcccaaaggcttgagccca
ttgatcctcaacgtcaatgtgcccgcctccaacccgctgaccaaggccaagtttgagctc
ggcaagcagctctacttcgacccgcgcgtctccctcgacggcacgatcagctgcgccacc
tgccacaatcccgagaaggggtggaccgatcagttgaagttctcgatcggcatcgacggg
cagaccggtggacgcaacgcgccgacggtggtcaacacggtctatgggaagacgatgttc
tgggacggtcgtgctccttcgctcgaaggacaggcacaaggaccgatccagaatccgatc
gagatgggcaagcagtcgtacgaagatatcgtgaagcgacttcgcacgattcccagctac
aaggagcaattcgcgacggtcttcggatcggacgtaaccctggatgggatggccaaggca
attgccaccttcgaacgcgtcgccgccctctcgggcaactcacggtacgacaagtacaac
tcgggcgacgatctggcggccttgtccgagagcgagaagcggggcatggtcctcttcggc
cttcggctccgtagcgaagacgagttcaagcccaacgtgactctcaagaaggccgactgc
acctcgtgccacaccggatccaacttcaccaacgagcagttccacaacatcggggtgggc
tggaacaccgagaagaacgacttcgccgactacggccggttcgtgatctcacccatcgga
tcgaagaacaacgccgagctcggcgcgttcaagaccccgacggtccgtgagatcgagaag
accggtccctacatgcacgacggcagcatgaagacgctcgaggaagtggtcgagcactac
aacaagggggggaacccgaacccggcgctcgataaggacatcaagaagctgaacctgacc
gactcggagaaagccgatgtcgtcgccttcttgaaagccctgaccggcgaggaaattaag
gtggccctgcccacccttccgcccggggccgatggcaagacgcccgacccccaagccgcg
ctgaccccgccccccttgaagaccgtctcgaatgtgttccatccggacgttcagcaataa

DBGET integrated database retrieval system