KEGG   Singulisphaera acidiphila: Sinac_5237Help
Entry
Sinac_5237        CDS       T02393                                 

Definition
(GenBank) protein-L-isoaspartate and D-aspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
saci  Singulisphaera acidiphila
Brite
Enzymes [BR:saci01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Sinac_5237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD Methyltransf_11 Methyltransf_23 Methyltransf_32 GCD14
Motif
Other DBs
NCBI-ProteinID: AGA29389
UniProt: L0DJ54
Position
6551191..6551973
Genome map
AA seq 260 aa AA seqDB search
MSLRATLVLVISVSFASQCLVDVRSRGDEPVAAAPVADPTEPARKRMVERHLVERGIKDP
RVLDAFRTVPRHRFLPESTSRQAYDDESIPIGEGQTITPPFDVAFMTESLQPKPTDKVYE
VGTGSGYQASILSRLVKEVYSVEIKPPLGKRAAQVIKDLGYTNIHTRIGDGYAGWPDAAP
FDAIIVTCAPEAIPQPLVDQLKEGGRIVIPVGNRFNQMVYYGTKKDGKLTLKELRPTLFV
PMTGRAQREAIEARKNKEKP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcattacgggcgacgctcgtgttagtgatcagtgtgagtttcgcgagccaatgcctc
gtcgatgttcgatctcgcggtgatgagcctgtggcggccgcgcctgtggctgatccgacg
gagcccgctcgcaagcgcatggtcgagcgtcacctggtggaacggggaatcaaggaccct
cgcgttctcgatgccttccgcaccgttcctcgccatcgctttctcccggaaagcaccagc
aggcaggcatacgacgacgaatcgatcccgatcggcgaggggcagacgatcacccccccc
ttcgacgtggcgttcatgaccgagtcgcttcagccgaagccgacggacaaagtctatgaa
gtcggcaccggttccggctatcaggcctcgattctttcgcgactggtcaaggaggtctat
tccgtcgagatcaagccgccgctggggaagcgggccgctcaagtcatcaaggatctcgga
tacacgaacattcacacccggatcggtgacggatacgccggctggcctgatgccgcaccg
tttgacgcgattatcgtcacctgtgcgccggaggcgatcccccaaccgctcgtcgaccag
ctcaaggagggggggcgaatcgtgattccggtggggaatcgattcaaccagatggtttac
tatgggacgaaaaaagacggcaagctgactctcaaggagctccgcccgaccttgttcgtt
cccatgaccggccgcgcgcagcgtgaggcgatcgaggctcggaagaacaaggagaagccg
tga

DBGET integrated database retrieval system