KEGG   Singulisphaera acidiphila: Sinac_5434Help
Entry
Sinac_5434        CDS       T02393                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
saci  Singulisphaera acidiphila
Brite
Enzymes [BR:saci01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Sinac_5434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6784750..6785481
Genome map
AA seq 243 aa AA seqDB search
MRTLTGNPIRAVGGVLPCLALLFALGAGGDEAADQARRLRMVTTQIEGRGITDPAVLAAM
RSVPRHRFVAEPLRAWAYDDCPLPIGHDQTISQPFVVAMMTASIHPKRGMKVLEVGTGSG
YQAAVLAACVGEVESIEVVPALGRQAEWLLKQLGCRNVHVRVGDGYDGWPERAPFDAVVL
TAAPERVPKPLLDQLRVGGRLVAPVGRGVQNLVVITKTQQGNVTKVIDSVWFVPMTGKAA
TER
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgctcaccgggaatcccattcgcgctgttgggggcgtacttccctgcctcgcg
ttacttttcgccctgggagcgggcggggacgaggccgctgaccaggcgcgccgactgcgg
atggttaccacccagatcgaagggcggggcatcaccgacccggcggtgctggcagcgatg
cggagtgtcccgcgtcaccggttcgttgccgaaccactccgggcatgggcctacgacgac
tgcccccttcccatcggccacgatcagacgatctcgcaaccgttcgtggtggcgatgatg
acagcgtcgatccacccgaaacggggtatgaaggttctcgaggtcgggaccggctcaggc
tatcaggcggcggtgctggcggcctgcgttggcgaggtggagagcatcgaggtggtgccg
gccctgggccggcaagccgaatggcttttgaagcagttgggctgtcggaacgtccatgtc
cgcgttggggacggttacgacggctggcccgagcgcgccccgtttgacgcggtggtgttg
accgctgcgccggagcgggttccgaagccgctcctcgaccaactccgtgtcgggggccgg
ttggtcgccccggtgggccggggcgtgcaaaatctcgtcgtgatcaccaagacccagcag
gggaacgtcacgaaagtcatcgactctgtttggtttgtgcccatgacgggtaaggctgca
acggaacgttga

DBGET integrated database retrieval system