KEGG   Singulisphaera acidiphila: Sinac_5465Help
Entry
Sinac_5465        CDS       T02393                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
saci  Singulisphaera acidiphila
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sinac_5465
Enzymes [BR:saci01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Sinac_5465
Peptidases [BR:saci01002]
 Cysteine Peptidases
  Family C44
   Sinac_5465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6828284..6830209
Genome map
AA seq 641 aa AA seqDB search
MCGIAGIIDLGGLTELDGRAVGPMTAALHHRGPDDSGTFVDGQAAIGHARLSIIDLATGH
QPMCNEDESIWIVFNGEIYNFPELHESLVARGHQFRSRCDTEAIIHLYEDHGERCVDFLR
GMFAFAIWDQKKRKLLLARDRLGIKPLYYWNDGTRLAFGSEIKAILQAPGVPRRISPEAL
HDYLTYLWVPAPKSMFEGIFKLPPGHTAVLDEHGARIRQYWDLSFPEPLRDSEEVLRERF
LAELEESVRIHLLSDVPLGAFLSGGLDSSAVVATMARLIAKPVVTNSIGFDESAFNELEY
ADAVAQKFDTDHHRQVVRPDAIDLVQRLAWHYDEPFADSSAIPTYCVSQMTRGNVTVALS
GDGGDENLAGYRKYKFHQRERQVRSLLPEPLRRLAFRPLGRLYPKADWLPRVLRARSTFQ
NLGSTDVEAIYRSRAAHEPSYALALIRPELRAAGYDPLGVIEDAYRRSDATDPLSRELYV
DIKTYLVDDILTKVDRASMAVGLEVRVPLLDHKFMEFMATIPSHMKLRGGQGKYLFKQAV
RPVLGVDVVDRPKMGFSVPLGAWFRGPLREIIEDTLFAPDAFIRSVLDTDEVRRIWRAHQ
AGISRMESMIWAVFMLEQWGRNFLSTSAGPLEPVPPAAARG
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggtatcgcggggattatcgacctgggcggtctgaccgagttggatggcagggcg
gtcgggccgatgaccgcggcgctgcaccaccgcggaccggacgattcgggcacgttcgtc
gacggtcaggctgcgatcggacatgcgcgactgagcatcatcgaccttgccacggggcat
cagccgatgtgcaacgaggacgagtccatctggatcgtcttcaacggcgagatctataat
tttccggaacttcacgaatcgcttgtggcccgggggcaccagttccggagccggtgcgac
accgaggcgatcatccacctttacgaggaccacggcgagcgctgcgtcgatttcctccgg
gggatgttcgccttcgcgatctgggaccagaagaagcgcaagttgctcctggcccgcgac
cgccttgggatcaagccgctctactactggaatgacggcacgcgattggctttcggctcc
gagatcaaggccattctccaagcccccggtgtgccaaggcggatcagccccgaggcgctg
cacgactacctcacctacctttgggtgccggcgccgaagtcgatgttcgaggggattttc
aagctcccccctggccacacggcagttctcgatgagcatggcgcccgaatccggcaatac
tgggacctttccttccctgagccactccgcgacagcgaagaagttttgcgcgagcgattc
cttgccgagctcgaggagtcggtccgcatccatctcctgtccgatgttcccctcggcgca
ttcctcagcggcggccttgattccagcgcagtcgtcgcgacgatggccaggctgatcgcg
aagccggtcgtcaccaactcgattggcttcgatgagtcggccttcaacgagttggagtat
gccgatgccgttgcgcagaaattcgatactgaccatcaccgccaagtcgtccgtcctgac
gccatcgaccttgtccaacggcttgcctggcactatgacgagccattcgccgatagctcg
gcgatcccgacctactgcgtctcgcagatgacccgtgggaacgttacggtcgctctctca
ggcgacggcggcgacgagaacttggccggttaccgcaagtataaattccaccagcgcgag
cgccaggtccggagccttcttcccgagccgctgcgacgtctcgccttccgaccgctcggc
cggctctatcccaaggccgactggctgccccgggtcctgcgagcgcgatccacctttcag
aaccttggctctacggatgtcgaggcgatctatcggagccgggccgcgcacgaacccagc
tatgcgctggccttgattcgtcccgagctgcgggctgcggggtatgatccgcttggcgtc
atcgaggatgcttaccgccgcagcgatgcgaccgacccgctgagtcgcgaactctacgtg
gatatcaagacctatctcgtcgacgacatcctcaccaaggtggaccgagcgtcgatggcc
gtggggctcgaggttcgggtccccctgttggaccacaagttcatggagttcatggccacc
atcccctcccacatgaagcttcgcggtggccagggtaagtacctgttcaagcaagcggtc
cgcccggttctcggagtggacgtcgtcgatcgcccgaagatgggcttctcggtgccgctc
ggagcgtggtttcgggggccgctccgtgaaatcatcgaggacactctgttcgcgcctgac
gctttcatccgctccgtgctcgacactgacgaggtccgacggatttggcgagcgcaccag
gccgggatcagccggatggagtcaatgatctgggccgtcttcatgctggagcaatgggga
cggaattttctctcgaccagcgctgggcctctcgaacccgtcccccccgccgccgcgcga
gggtaa

DBGET integrated database retrieval system