KEGG   Singulisphaera acidiphila: Sinac_6537Help
Entry
Sinac_6537        CDS       T02393                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
saci  Singulisphaera acidiphila
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sinac_6537
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sinac_6537
  Amino acid metabolism
   00310 Lysine degradation
    Sinac_6537
Enzymes [BR:saci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sinac_6537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8221620..8222882
Genome map
AA seq 420 aa AA seqDB search
MPAVAITVPGVGESITEGILSRWLKADGSAVKAGEPLFELETDKANNVVPASASGVLKIN
VAEGETVDIGSTVGTIDPEGQPTAAAPTANDSKQVSAPPKAAATPAPAVASDSNGGAAAA
LSPAVRRIVAEEKVDASQVGGTGRGGRITKGDVLAHLATPSSEPAAPTAAAAAPSPQPSN
GAAAPSGLPRETRKRMSGIRQKIAQRLVEAQQTAAILTTFNEADMSRVMDLRARYKDTFK
TKHGVALGFMSFFLKAAVEALKAFPAVNGRIDGNEIVLHNAYDIGVAVSTERGLMVPVIR
DADRLSFAGIEKAIGAFAVKAREGTMAVSDLQGGTFTITNGGVFGSLLSTPILNPPQSGI
LGMHSIQKRPVAIDDQVVIRPMMYLALSYDHRIVDGREAVSFLVRIKECIENPERLMLEI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgtcgccattaccgtgccgggagtcggcgagtccattaccgaagggatcctg
tcacgctggctcaaggccgacggttcggccgtcaaagcgggcgaacccttgttcgagctc
gaaaccgacaaggcgaacaacgtcgtgcccgcctccgcctcgggcgtcctgaaaatcaac
gtcgccgagggggagaccgtggatatcggctccacggtcggcaccatcgaccccgaggga
cagcccacagctgcggcgcccacagccaacgactccaagcaggtttctgctcctcccaag
gcggcagcgactccagcaccggcggtcgcgagcgattccaacggaggcgcagccgcagcg
ctctctccggccgtgcgccggatcgtagccgaggaaaaggtcgacgccagccaggttggc
gggaccggccgagggggacggatcaccaagggggacgtcctcgctcacctcgccacgccc
tccagcgaacccgctgccccgacagcagcagcggcggccccctcgccccagcccagtaac
ggagcggcggccccctcgggtctgccgcgtgaaaccaggaagcggatgtccgggatccgc
cagaagattgcgcagcgcctggtcgaagcgcagcagaccgccgcgatcctgacgacgttc
aacgaggcggacatgtcgcgggtcatggacctgcgggcccgttacaaggacacgttcaag
acgaagcacggcgtggccctcggcttcatgtcgttcttcctcaaggcggcggtcgaggcc
ctgaaggcgttcccggcggtcaacggccggatcgacggcaacgagatcgtcctccacaac
gcctatgacatcggcgtggccgtcagcaccgagcgcggcctgatggtcccggtcattcgg
gacgccgaccggctgagcttcgccggaatcgaaaaggcgatcggcgctttcgccgtcaag
gcccgcgaagggacgatggccgtcagcgaccttcaaggcggcacgttcacgatcaccaac
ggcggcgtcttcggatcactcctgtcgacgcccatcctgaatccgccgcagagcggaatc
ctcgggatgcactcgatccagaaacggcccgtcgccatcgacgaccaggtcgtgatccgc
ccgatgatgtacctggcactctcgtacgaccaccgcatcgtcgacggtcgcgaggcggtc
agcttcctcgttcgcatcaaagaatgcattgagaatcccgaacggctgatgctggaaatc
tga

DBGET integrated database retrieval system