KEGG   Singulisphaera acidiphila: Sinac_6537Help
Entry
Sinac_6537        CDS       T02393                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
saci  Singulisphaera acidiphila
Pathway
saci00020  Citrate cycle (TCA cycle)
saci00310  Lysine degradation
saci01100  Metabolic pathways
saci01110  Biosynthesis of secondary metabolites
saci01120  Microbial metabolism in diverse environments
saci01130  Biosynthesis of antibiotics
saci01200  Carbon metabolism
Module
saci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
saci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sinac_6537
  Amino acid metabolism
   00310 Lysine degradation
    Sinac_6537
Enzymes [BR:saci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sinac_6537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AGA30612
UniProt: L0DMY5
Position
8221620..8222882
Genome map
AA seq 420 aa AA seqDB search
MPAVAITVPGVGESITEGILSRWLKADGSAVKAGEPLFELETDKANNVVPASASGVLKIN
VAEGETVDIGSTVGTIDPEGQPTAAAPTANDSKQVSAPPKAAATPAPAVASDSNGGAAAA
LSPAVRRIVAEEKVDASQVGGTGRGGRITKGDVLAHLATPSSEPAAPTAAAAAPSPQPSN
GAAAPSGLPRETRKRMSGIRQKIAQRLVEAQQTAAILTTFNEADMSRVMDLRARYKDTFK
TKHGVALGFMSFFLKAAVEALKAFPAVNGRIDGNEIVLHNAYDIGVAVSTERGLMVPVIR
DADRLSFAGIEKAIGAFAVKAREGTMAVSDLQGGTFTITNGGVFGSLLSTPILNPPQSGI
LGMHSIQKRPVAIDDQVVIRPMMYLALSYDHRIVDGREAVSFLVRIKECIENPERLMLEI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgtcgccattaccgtgccgggagtcggcgagtccattaccgaagggatcctg
tcacgctggctcaaggccgacggttcggccgtcaaagcgggcgaacccttgttcgagctc
gaaaccgacaaggcgaacaacgtcgtgcccgcctccgcctcgggcgtcctgaaaatcaac
gtcgccgagggggagaccgtggatatcggctccacggtcggcaccatcgaccccgaggga
cagcccacagctgcggcgcccacagccaacgactccaagcaggtttctgctcctcccaag
gcggcagcgactccagcaccggcggtcgcgagcgattccaacggaggcgcagccgcagcg
ctctctccggccgtgcgccggatcgtagccgaggaaaaggtcgacgccagccaggttggc
gggaccggccgagggggacggatcaccaagggggacgtcctcgctcacctcgccacgccc
tccagcgaacccgctgccccgacagcagcagcggcggccccctcgccccagcccagtaac
ggagcggcggccccctcgggtctgccgcgtgaaaccaggaagcggatgtccgggatccgc
cagaagattgcgcagcgcctggtcgaagcgcagcagaccgccgcgatcctgacgacgttc
aacgaggcggacatgtcgcgggtcatggacctgcgggcccgttacaaggacacgttcaag
acgaagcacggcgtggccctcggcttcatgtcgttcttcctcaaggcggcggtcgaggcc
ctgaaggcgttcccggcggtcaacggccggatcgacggcaacgagatcgtcctccacaac
gcctatgacatcggcgtggccgtcagcaccgagcgcggcctgatggtcccggtcattcgg
gacgccgaccggctgagcttcgccggaatcgaaaaggcgatcggcgctttcgccgtcaag
gcccgcgaagggacgatggccgtcagcgaccttcaaggcggcacgttcacgatcaccaac
ggcggcgtcttcggatcactcctgtcgacgcccatcctgaatccgccgcagagcggaatc
ctcgggatgcactcgatccagaaacggcccgtcgccatcgacgaccaggtcgtgatccgc
ccgatgatgtacctggcactctcgtacgaccaccgcatcgtcgacggtcgcgaggcggtc
agcttcctcgttcgcatcaaagaatgcattgagaatcccgaacggctgatgctggaaatc
tga

DBGET integrated database retrieval system