KEGG   Singulisphaera acidiphila: Sinac_6636Help
Entry
Sinac_6636        CDS       T02393                                 

Definition
sulfite reductase subunit alpha
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
saci  Singulisphaera acidiphila
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Sinac_6636
  Amino acid metabolism
   00380 Tryptophan metabolism
    Sinac_6636
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sinac_6636
Enzymes [BR:saci01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Sinac_6636
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Sinac_6636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8351371..8354616
Genome map
AA seq 1081 aa AA seqDB search
MDVEKAAGLEPIPQPTAWPVLGNLNALDRRAPLQSFIRLAKEHGPIYRLDLPGRKLVILS
SQELVNEACDEQRFDKLISTALGKVRSFSGDGLFTAWTFEPNWSKAHGILMPNFGAKAMQ
GYLPQMIDIADQLVAKWSRLNPDEVIDVADDMTRLTLDTIGLCGFDYRFNSFYREDPHPF
VQAMVRSLGESLLQANRLPLQEALLFRTHRRHEQDIAYMNAVVDRLIQERRADPQAMATK
KDLLNYMLTGLDKKTGEGLDDVNIRYQILTFLIAGHETTSGLLSFALYFLLNHPETLTKA
YEEVDRVLGTDPESTPTLSQVHQLAYVQQILKESLRLWPTAPAFALYPREETTLGGRFAL
SKGENLVVLLPMLHRDPSVWGADAEEFRPSRFAPEQERQLPSNAYKPFGNGQRACIGQQF
AMQEATLVLGMILRRFEPIDHANYRLRVKETLTLKPDGFTMKVRPRGARVRTTVSAVPMA
LSVAQETAEAAAPPPAGQGTPLLILYGSNLGTAEGFAQRIAEDGRSLGFSVATAALDDAT
SDLPREGALIIVTSSYNGAPPDNAARFCDWLQKGNTGPAGFQGVRYAIFGCGDHNWSATY
QAIPKLIDQKLAAGGATRLHERGEGDAADDLDGQFQTWYGLLWTRIASALGLQIKAEAKP
RAAYRIETVDTQVDLPFVAAYSAHRMTVVASRELQQAGDAKAPERSTRHIELALPDGVRY
HTGNHLGVLPRNRGGAIRRVLERFRLDGDSQVIIRRDDAGKSNLPLDRPIRLAELVGGYV
ELQDPATRDQIRVLADKALCPPDKARLTPLVGDDEASLARYREEVFLPRRSVLDLLELNP
SCVLAFEEFLGMLPPLRPRYYSISSSPLINERIASITVAVVRDASRSGLGLYEGVASNYL
AELTEGSEILGFVRGPGTPFQPPADPRTPMIMVGAGTGLAPFRGFLQERKALKDRGHDVG
PSLLFFGCRNPSHDFLYEKELRDFEAKGLTHLIPAFSRVSGQPKCYVQHSILQNAESVWD
LLDHGAVVYVCGDAARLAPDVRAAFHNISAAKTGHDGRVADSWLYELQSNNRYLEDVWAS
G
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atggacgttgagaaagcagcagggctcgagccaattccccagccgacagcctggcccgtc
ctgggcaacctgaatgcgctcgaccggcgggcaccgctccagagcttcatccgcctcgcg
aaggagcacggtccgatctaccggctggacctgccggggcggaagctcgtgatcctctcg
agccaggagctggtcaacgaggcctgtgatgagcaacgctttgataagttgatcagcacg
gccttgggcaaagtccggagcttctccggcgacggcctgttcaccgcctggaccttcgag
ccgaattggtccaaggcgcacggcatcctgatgccgaacttcggcgccaaggcgatgcag
ggctacctgccgcaaatgatcgacatcgccgaccagctcgtcgccaagtggtcgaggctc
aaccccgatgaggtcatcgacgtcgccgacgacatgacccgcctgacgctcgacaccatc
ggtctctgcggattcgactaccgcttcaactcgttctaccgcgaagatccccacccgttc
gtccaggcgatggtccgctcgctcggcgagtcgctcctccaagccaaccggctccccctt
caagaggccctcctgttccgcacccaccgccgccatgagcaggacatcgcctacatgaat
gcggtcgtggaccgactgatccaggagcgccgggccgacccacaagcgatggccaccaag
aaggacctgctcaactacatgcttaccggcctggataagaagaccggggaggggctcgac
gacgtcaacatccgctaccagatcctcaccttcctgatcgccggccacgagacgacaagc
ggcctcctttccttcgccctctacttcctcctgaaccatcccgagaccctcaccaaggcg
tatgaggaagtggaccgcgtcctcggcaccgacccggagtcgaccccgacgctgagccag
gtccaccagcttgcctacgtccagcagattctcaaggagtcgctccggctctggccgacc
gcccccgccttcgcgctctacccgcgcgaggagacgaccctcggcggccgcttcgccttg
agcaagggggaaaacctggtcgtcctgctcccaatgctccaccgcgacccgagcgtctgg
ggagcggacgccgaggagttccggccgtctcggttcgctccggaacaggagcggcaactc
ccctcgaatgcgtacaaaccgttcggcaacggtcagcgggcctgcatcggccagcagttc
gcgatgcaggaggcgacgctcgtcctcggaatgatcctcaggcggttcgagcccatcgat
cacgccaactaccggcttcgcgtgaaggagacgctcaccctgaagcctgacggcttcacc
atgaaggtccggccgcgcggggcgcgagtccggaccaccgtttccgccgtaccgatggcc
ctgagcgtggcccaggaaacggcggaggccgcggctcctcctccggccggccaaggcacc
ccgctcttgatcctctatggctcgaaccttggcaccgcagaaggattcgcccagcggatc
gccgaggacggccggtccctcggcttctccgtcgcgaccgcagcgctcgatgacgccacg
agcgacctgccccgcgagggcgcactgattatcgtcacctcctcctacaacggagcccca
cccgacaacgcggcccgcttctgcgactggcttcaaaagggaaacaccggtcccgccggg
ttccaaggcgtgcgatacgccatcttcggatgtggagaccacaactggtcggccacctat
caggcgatcccgaagctcatcgaccagaagctcgccgcgggcggggcgacccggctccat
gagcgcggtgaaggggatgccgcggacgacctcgatggccagttccagacctggtacggc
ctcctctggacccggatcgcttcggccttggggctccagatcaaggccgaagccaagccg
agggctgcgtatcggatcgagacggtcgacacgcaagtcgacctcccgttcgtcgcagcc
tattccgcccatcgcatgaccgtggtcgccagccgggaactccaacaggcaggtgacgca
aaggctcccgagcgctcgacccgacacatcgagttggccttgcccgacggagtccgttac
cacaccgggaatcatctcggcgttctaccgcgcaatcgagggggagcgatccgccgcgtc
ctcgaacggttccggctcgatggcgattcccaggtcatcatccgccgcgacgacgcgggc
aaatcgaatctgccactcgatcggccgatccgcctcgcggaactggtcggaggctacgtc
gagctccaggacccggcgactcgcgaccagatacgagtcctcgccgacaaggccctctgc
ccccccgacaaggcaaggctgactcccctcgtcggcgacgacgaggcgagcctcgcccgc
taccgcgaggaggtcttcctcccgcgccgctcggtgctcgacctgctcgaactcaacccg
tcgtgtgtgcttgcgttcgaggaattcctcggcatgctgccgccgcttcggccacggtac
tattcgatctcgtcctcaccgctcatcaacgaacggatcgcgagcatcacggtcgcggtg
gtccgggacgcatcccgctccggcctcggcctgtacgaaggggtggcctcgaactacctc
gccgaactgacggaggggagcgagatcctcggcttcgttcgcggccccggcacccccttt
caaccaccggccgacccgcgcacgccaatgatcatggttggtgccggcaccggcctggct
ccgttccgcggcttcctccaggaacgcaaagccctcaaggatcgcggccatgacgtcggt
ccgtcgctcctcttcttcggctgccgcaacccgagccacgatttcctctacgagaaggaa
ctccgcgactttgaggcgaagggcctgacgcacctcatcccggccttctcccgggtctcg
ggacagccaaaatgctatgttcagcatagcattctccaaaacgccgagagcgtctgggac
ctgctcgaccatggagcggtggtctacgtctgcggcgatgccgcgcgactggcccctgat
gtccgggccgccttccacaacatcagtgcagcaaagacgggacatgacggtcgcgttgcg
gactcgtggctctacgagctacaatcgaacaatcggtatctcgaagacgtttgggcatct
ggataa

DBGET integrated database retrieval system