KEGG   Singulisphaera acidiphila: Sinac_6636Help
Entry
Sinac_6636        CDS       T02393                                 

Definition
sulfite reductase subunit alpha
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
saci  Singulisphaera acidiphila
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:saci00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:saci00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:saci00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8351371..8354616
Genome map
AA seq 1081 aa AA seqDB search
MDVEKAAGLEPIPQPTAWPVLGNLNALDRRAPLQSFIRLAKEHGPIYRLDLPGRKLVILS
SQELVNEACDEQRFDKLISTALGKVRSFSGDGLFTAWTFEPNWSKAHGILMPNFGAKAMQ
GYLPQMIDIADQLVAKWSRLNPDEVIDVADDMTRLTLDTIGLCGFDYRFNSFYREDPHPF
VQAMVRSLGESLLQANRLPLQEALLFRTHRRHEQDIAYMNAVVDRLIQERRADPQAMATK
KDLLNYMLTGLDKKTGEGLDDVNIRYQILTFLIAGHETTSGLLSFALYFLLNHPETLTKA
YEEVDRVLGTDPESTPTLSQVHQLAYVQQILKESLRLWPTAPAFALYPREETTLGGRFAL
SKGENLVVLLPMLHRDPSVWGADAEEFRPSRFAPEQERQLPSNAYKPFGNGQRACIGQQF
AMQEATLVLGMILRRFEPIDHANYRLRVKETLTLKPDGFTMKVRPRGARVRTTVSAVPMA
LSVAQETAEAAAPPPAGQGTPLLILYGSNLGTAEGFAQRIAEDGRSLGFSVATAALDDAT
SDLPREGALIIVTSSYNGAPPDNAARFCDWLQKGNTGPAGFQGVRYAIFGCGDHNWSATY
QAIPKLIDQKLAAGGATRLHERGEGDAADDLDGQFQTWYGLLWTRIASALGLQIKAEAKP
RAAYRIETVDTQVDLPFVAAYSAHRMTVVASRELQQAGDAKAPERSTRHIELALPDGVRY
HTGNHLGVLPRNRGGAIRRVLERFRLDGDSQVIIRRDDAGKSNLPLDRPIRLAELVGGYV
ELQDPATRDQIRVLADKALCPPDKARLTPLVGDDEASLARYREEVFLPRRSVLDLLELNP
SCVLAFEEFLGMLPPLRPRYYSISSSPLINERIASITVAVVRDASRSGLGLYEGVASNYL
AELTEGSEILGFVRGPGTPFQPPADPRTPMIMVGAGTGLAPFRGFLQERKALKDRGHDVG
PSLLFFGCRNPSHDFLYEKELRDFEAKGLTHLIPAFSRVSGQPKCYVQHSILQNAESVWD
LLDHGAVVYVCGDAARLAPDVRAAFHNISAAKTGHDGRVADSWLYELQSNNRYLEDVWAS
G
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atggacgttgagaaagcagcagggctcgagccaattccccagccgacagcctggcccgtc
ctgggcaacctgaatgcgctcgaccggcgggcaccgctccagagcttcatccgcctcgcg
aaggagcacggtccgatctaccggctggacctgccggggcggaagctcgtgatcctctcg
agccaggagctggtcaacgaggcctgtgatgagcaacgctttgataagttgatcagcacg
gccttgggcaaagtccggagcttctccggcgacggcctgttcaccgcctggaccttcgag
ccgaattggtccaaggcgcacggcatcctgatgccgaacttcggcgccaaggcgatgcag
ggctacctgccgcaaatgatcgacatcgccgaccagctcgtcgccaagtggtcgaggctc
aaccccgatgaggtcatcgacgtcgccgacgacatgacccgcctgacgctcgacaccatc
ggtctctgcggattcgactaccgcttcaactcgttctaccgcgaagatccccacccgttc
gtccaggcgatggtccgctcgctcggcgagtcgctcctccaagccaaccggctccccctt
caagaggccctcctgttccgcacccaccgccgccatgagcaggacatcgcctacatgaat
gcggtcgtggaccgactgatccaggagcgccgggccgacccacaagcgatggccaccaag
aaggacctgctcaactacatgcttaccggcctggataagaagaccggggaggggctcgac
gacgtcaacatccgctaccagatcctcaccttcctgatcgccggccacgagacgacaagc
ggcctcctttccttcgccctctacttcctcctgaaccatcccgagaccctcaccaaggcg
tatgaggaagtggaccgcgtcctcggcaccgacccggagtcgaccccgacgctgagccag
gtccaccagcttgcctacgtccagcagattctcaaggagtcgctccggctctggccgacc
gcccccgccttcgcgctctacccgcgcgaggagacgaccctcggcggccgcttcgccttg
agcaagggggaaaacctggtcgtcctgctcccaatgctccaccgcgacccgagcgtctgg
ggagcggacgccgaggagttccggccgtctcggttcgctccggaacaggagcggcaactc
ccctcgaatgcgtacaaaccgttcggcaacggtcagcgggcctgcatcggccagcagttc
gcgatgcaggaggcgacgctcgtcctcggaatgatcctcaggcggttcgagcccatcgat
cacgccaactaccggcttcgcgtgaaggagacgctcaccctgaagcctgacggcttcacc
atgaaggtccggccgcgcggggcgcgagtccggaccaccgtttccgccgtaccgatggcc
ctgagcgtggcccaggaaacggcggaggccgcggctcctcctccggccggccaaggcacc
ccgctcttgatcctctatggctcgaaccttggcaccgcagaaggattcgcccagcggatc
gccgaggacggccggtccctcggcttctccgtcgcgaccgcagcgctcgatgacgccacg
agcgacctgccccgcgagggcgcactgattatcgtcacctcctcctacaacggagcccca
cccgacaacgcggcccgcttctgcgactggcttcaaaagggaaacaccggtcccgccggg
ttccaaggcgtgcgatacgccatcttcggatgtggagaccacaactggtcggccacctat
caggcgatcccgaagctcatcgaccagaagctcgccgcgggcggggcgacccggctccat
gagcgcggtgaaggggatgccgcggacgacctcgatggccagttccagacctggtacggc
ctcctctggacccggatcgcttcggccttggggctccagatcaaggccgaagccaagccg
agggctgcgtatcggatcgagacggtcgacacgcaagtcgacctcccgttcgtcgcagcc
tattccgcccatcgcatgaccgtggtcgccagccgggaactccaacaggcaggtgacgca
aaggctcccgagcgctcgacccgacacatcgagttggccttgcccgacggagtccgttac
cacaccgggaatcatctcggcgttctaccgcgcaatcgagggggagcgatccgccgcgtc
ctcgaacggttccggctcgatggcgattcccaggtcatcatccgccgcgacgacgcgggc
aaatcgaatctgccactcgatcggccgatccgcctcgcggaactggtcggaggctacgtc
gagctccaggacccggcgactcgcgaccagatacgagtcctcgccgacaaggccctctgc
ccccccgacaaggcaaggctgactcccctcgtcggcgacgacgaggcgagcctcgcccgc
taccgcgaggaggtcttcctcccgcgccgctcggtgctcgacctgctcgaactcaacccg
tcgtgtgtgcttgcgttcgaggaattcctcggcatgctgccgccgcttcggccacggtac
tattcgatctcgtcctcaccgctcatcaacgaacggatcgcgagcatcacggtcgcggtg
gtccgggacgcatcccgctccggcctcggcctgtacgaaggggtggcctcgaactacctc
gccgaactgacggaggggagcgagatcctcggcttcgttcgcggccccggcacccccttt
caaccaccggccgacccgcgcacgccaatgatcatggttggtgccggcaccggcctggct
ccgttccgcggcttcctccaggaacgcaaagccctcaaggatcgcggccatgacgtcggt
ccgtcgctcctcttcttcggctgccgcaacccgagccacgatttcctctacgagaaggaa
ctccgcgactttgaggcgaagggcctgacgcacctcatcccggccttctcccgggtctcg
ggacagccaaaatgctatgttcagcatagcattctccaaaacgccgagagcgtctgggac
ctgctcgaccatggagcggtggtctacgtctgcggcgatgccgcgcgactggcccctgat
gtccgggccgccttccacaacatcagtgcagcaaagacgggacatgacggtcgcgttgcg
gactcgtggctctacgagctacaatcgaacaatcggtatctcgaagacgtttgggcatct
ggataa

DBGET integrated database retrieval system