KEGG   Singulisphaera acidiphila: Sinac_6665Help
Entry
Sinac_6665        CDS       T02393                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
saci  Singulisphaera acidiphila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sinac_6665
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sinac_6665
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sinac_6665
Enzymes [BR:saci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sinac_6665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8397840..8399108
Genome map
AA seq 422 aa AA seqDB search
MSGEFVSGLKCRLCGKVYPKEALNFCTEDFGPLEVAYNYEAVAKSFTRQAIESRPRTMWR
YRELLPVDGEPTVGRHVGGTPLIRADRLAKALGLRELYVKNDAVNHPSLSFKDRVVAVAL
SKAVELGFETVGCASTGNLAGSVAANAAAAGLNAYVLIPDNLEQGKVLGATIYGAKVIAI
QGNYDHVNRLCSQIAFRFGWGFVNVNLRPFYAEGSKSMGFEIAEDMGWRIPDQVVVPMAG
GSLIGKLHKSFKELERLGLVSGPVNTKMYGAQATGCNPIANTVKTDALRVKPVRNPDTIA
KSLAIGDPADGYFASQLIRDTGGWSEDVDDDAIVDSMRLLAETEGIWAETAGGVTVAVAR
KLIAQGKIDRDASTVLCITGNGLKTQEALIDKIARPVVIKPSLAEFEALVGAESPELVAT
EA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgtctggagaattcgtcagcgggctgaagtgtcgtctctgtggtaaggtctaccccaag
gaagctctcaacttctgtaccgaggacttcggcccgctcgaagtcgcgtacaactacgag
gcggtcgcgaagtccttcaccaggcaggcgattgaatcgcgtcccaggacgatgtggcgc
tatcgcgagttgctccccgtggatggcgagccgaccgttggccggcacgtgggcggcacc
cctttgatccgggccgatcgcctcgccaaggcgcttgggctccgcgagctctacgtcaag
aacgacgccgtcaatcatccctcgctctcgttcaaagaccgcgtcgtggccgtcgcgttg
tcgaaggcggttgagcttggctttgagacggtcggatgcgcctcgacgggcaacctcgcc
ggcagtgtcgcggccaatgcggccgccgcgggcttgaatgcttacgtcttgattcccgac
aacctcgagcagggcaaagtcctcggcgccacgatctacggggccaaggtcatcgcgatc
caaggcaattacgaccacgtcaaccgcctctgctcgcagatcgcctttcggttcggctgg
gggttcgtcaacgtcaacctccgcccgttctacgctgaggggtcgaagtcgatgggcttc
gagatcgccgaagatatgggctggcggattcccgaccaggtcgtcgtgccgatggccggc
ggcagcctgatcggcaagctccacaagtcgttcaaggaactcgagcggctcggcctggtc
tcgggaccggtcaataccaaaatgtacggggcgcaagccaccggctgcaaccccatcgcg
aacacggtcaagaccgacgccctccgggtcaagccggttcgcaacccggacacgatcgcc
aagagcctcgccatcggcgacccggccgacggctacttcgcctcgcagctcatccgcgac
accggcggctggagcgaagacgtggacgacgacgcaatcgtcgattcgatgcgactcctg
gccgagaccgaggggatctgggccgagaccgccggcggcgtgaccgtcgccgtggctcgg
aagctgatcgcccaaggcaagatcgaccgtgacgcctcgaccgtcctctgcatcacgggc
aacggcctcaagacgcaggaagccctgatcgacaagatcgcccggccggtcgtcatcaag
ccgagcctggcggagtttgaggccctggtcggggccgagtcgccggagctggtcgccacc
gaggcttga

DBGET integrated database retrieval system