KEGG   Singulisphaera acidiphila: Sinac_6665Help
Entry
Sinac_6665        CDS       T02393                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
saci  Singulisphaera acidiphila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sinac_6665
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sinac_6665
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sinac_6665
Enzymes [BR:saci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sinac_6665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8397840..8399108
Genome map
AA seq 422 aa AA seqDB search
MSGEFVSGLKCRLCGKVYPKEALNFCTEDFGPLEVAYNYEAVAKSFTRQAIESRPRTMWR
YRELLPVDGEPTVGRHVGGTPLIRADRLAKALGLRELYVKNDAVNHPSLSFKDRVVAVAL
SKAVELGFETVGCASTGNLAGSVAANAAAAGLNAYVLIPDNLEQGKVLGATIYGAKVIAI
QGNYDHVNRLCSQIAFRFGWGFVNVNLRPFYAEGSKSMGFEIAEDMGWRIPDQVVVPMAG
GSLIGKLHKSFKELERLGLVSGPVNTKMYGAQATGCNPIANTVKTDALRVKPVRNPDTIA
KSLAIGDPADGYFASQLIRDTGGWSEDVDDDAIVDSMRLLAETEGIWAETAGGVTVAVAR
KLIAQGKIDRDASTVLCITGNGLKTQEALIDKIARPVVIKPSLAEFEALVGAESPELVAT
EA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgtctggagaattcgtcagcgggctgaagtgtcgtctctgtggtaaggtctaccccaag
gaagctctcaacttctgtaccgaggacttcggcccgctcgaagtcgcgtacaactacgag
gcggtcgcgaagtccttcaccaggcaggcgattgaatcgcgtcccaggacgatgtggcgc
tatcgcgagttgctccccgtggatggcgagccgaccgttggccggcacgtgggcggcacc
cctttgatccgggccgatcgcctcgccaaggcgcttgggctccgcgagctctacgtcaag
aacgacgccgtcaatcatccctcgctctcgttcaaagaccgcgtcgtggccgtcgcgttg
tcgaaggcggttgagcttggctttgagacggtcggatgcgcctcgacgggcaacctcgcc
ggcagtgtcgcggccaatgcggccgccgcgggcttgaatgcttacgtcttgattcccgac
aacctcgagcagggcaaagtcctcggcgccacgatctacggggccaaggtcatcgcgatc
caaggcaattacgaccacgtcaaccgcctctgctcgcagatcgcctttcggttcggctgg
gggttcgtcaacgtcaacctccgcccgttctacgctgaggggtcgaagtcgatgggcttc
gagatcgccgaagatatgggctggcggattcccgaccaggtcgtcgtgccgatggccggc
ggcagcctgatcggcaagctccacaagtcgttcaaggaactcgagcggctcggcctggtc
tcgggaccggtcaataccaaaatgtacggggcgcaagccaccggctgcaaccccatcgcg
aacacggtcaagaccgacgccctccgggtcaagccggttcgcaacccggacacgatcgcc
aagagcctcgccatcggcgacccggccgacggctacttcgcctcgcagctcatccgcgac
accggcggctggagcgaagacgtggacgacgacgcaatcgtcgattcgatgcgactcctg
gccgagaccgaggggatctgggccgagaccgccggcggcgtgaccgtcgccgtggctcgg
aagctgatcgcccaaggcaagatcgaccgtgacgcctcgaccgtcctctgcatcacgggc
aacggcctcaagacgcaggaagccctgatcgacaagatcgcccggccggtcgtcatcaag
ccgagcctggcggagtttgaggccctggtcggggccgagtcgccggagctggtcgccacc
gaggcttga

DBGET integrated database retrieval system