KEGG   Singulisphaera acidiphila: Sinac_6988Help
Entry
Sinac_6988        CDS       T02393                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
saci  Singulisphaera acidiphila
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:saci00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8825901..8827208
Genome map
AA seq 435 aa AA seqDB search
MSRKRDLIHPRDEIMRAMERIYRYRMTTTSGGNLSIRDEAGDLWITPARVDKGSLRREDI
VHVRADGTVDGPHPPSSELPFHRAIYEARPDARGIVHAHPVALVAFSICRRTPDTRLLPQ
ARQICGEAGFAPYALPGSQALGANIAQTFAAGSDCVVLENHGVVTAGSNLQEAFERFETL
EFTAKTIIKASLLGEVRYLDDEQAGRRPQPSASTKSPALFQPGAATSREKELRRQLCEFV
RRSYQQRLMISTEGAFSARLDDDSFLITPHRVDRNMLDPDAIVLIHKGATEEGKVPSSAV
RNHEAIYQSHPKIHSVVNAYPVNATAFSVTTTTLDPRTIPESYIFLRDVHRIPYGVQQGD
GRELARLTSLRDPVLIFENDGVQVCGSSVLDAFDRLEVLESTAEAMINGFALNKGTIHRM
PDAVISELNQAFGLE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaaagcgcgaccttatccacccgcgcgacgagatcatgcgcgcgatggagcgg
atctaccgctatcggatgacgaccacgtccggcgggaacctctcgatccgggacgaggcg
ggcgacctctggatcacccccgcccgcgtcgacaagggaagcctgcgccgcgaggacatc
gtccacgttcgcgcggacggaaccgtcgacggcccacatcctccttcgtcagagctcccc
ttccaccgtgccatctacgaggcccgccccgacgcccgagggatcgtccacgcgcacccg
gtcgcgctcgtcgccttcagcatctgccggcgcactcccgacacacgtttactgccccag
gccaggcaaatctgcggcgaggcgggcttcgccccctacgcgctccccggcagccaggcg
ctgggggccaacatcgcccagaccttcgcggcaggatccgactgcgtggtgctcgagaac
catggcgtcgtgaccgccggttcgaatctccaagaggccttcgaacgcttcgagaccctc
gagttcaccgccaagacgatcatcaaggcgagcctgctcggcgaggtccgctatctcgac
gacgagcaggccgggcgacggccccagccctcagcctccaccaagtcccctgccctattt
cagccaggggcggccacgagccgtgagaaagaactgcgccggcagctctgcgagttcgtc
cgccgcagttatcagcaacggctgatgatcagtaccgaaggcgcattctcggcccggctc
gacgacgactcattcctgatcaccccccaccgggtcgaccgcaacatgctcgaccccgac
gcgattgtcctcatccacaaaggcgcgaccgaagagggcaaggtccccagttccgcggtc
cgcaaccatgaggcgatctatcagagccaccccaagatccactctgtggtcaacgcctac
ccggtgaacgcaacggccttcagcgtaacgacgacgaccctcgacccacgaacgattcct
gaaagttacatctttctccgggacgttcaccggatcccctacggcgtccaacagggcgac
ggtcgcgaactggcccggctgacctccttgcgcgacccggtcctgatcttcgagaacgac
ggagtccaagtctgcggctccagcgtcctcgacgcattcgaccggctcgaagtcctcgag
tcgaccgccgaggcgatgatcaacggcttcgccctcaacaaaggcacgatccatcggatg
cccgacgccgtcatctccgagttgaaccaggcgttcggactggagtga

DBGET integrated database retrieval system