KEGG   Singulisphaera acidiphila: Sinac_7136Help
Entry
Sinac_7136        CDS       T02393                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
saci  Singulisphaera acidiphila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sinac_7136
Enzymes [BR:saci01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Sinac_7136
Exosome [BR:saci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sinac_7136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9054265..9056181
Genome map
AA seq 638 aa AA seqDB search
MPASLNHVTASTPMGANLIADGATFRVWAPNAVKVFVLGEFNGKVKDDSSLLTKDANGHW
RGFIKGAKDRHRYIFHIDGTGSSGPKRDPYARELQKPFPSDCIIRKTDFPWHETGFVTPR
FNNFVIYQLHVGTFYTPNLPKKAGTFLDVARKIPHLSQLGVTVLQLLPIQEFQTAFSLGY
NGTDYFSPEMDFAVEDADLKPYVDEVNSLLDAKSLPRYKVDNLRGEMNQLKALIDLCHIH
GLAMILDVVYNHAGGDFGDQSLLFFDRQPTSGGKAKNSLYFNGREHAGGEVFDFGKPEVR
DFLIQNAKFFLDEYRVDGLRYDQVSAIDHDGSPRGWSFCQDLTSTLNHHRPSAIDHAEYW
NVNPYVVKPPSEGAGFDTTLTDGLRIAIRNVISNAAQPDERPLNMSGLASSMWPEGFPEQ
WRIVQGPENHDIVYRDREQRVARLGDFNNPRSWFGRSRARVATGICLTAPGIPMLFMGQE
FLEDKQWADDIEHHANLLLFWAGVEGSDKQMLDHIRFTRELLGVRWQQPALRGEGFRPVH
VHDQNRVLAFHRWVPNEGHDVMVVVHLSTFNRFDYRIGFPSGGEWREVFNSDVYENWVNP
GTTGNGGRIFADQNPMHGFDSSASLVLPANSVMVFARG
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcctccctgaaccatgtgacggccagcacccccatgggtgcgaatctgatcgcc
gacggtgcgaccttccgagtttgggcaccgaacgccgtaaaggtattcgttcttggcgag
ttcaatggcaaagtaaaggatgattccagcctattgaccaaagatgccaacggtcactgg
cggggtttcatcaagggcgcaaaagaccgtcatcgctacatatttcatattgatggcacg
ggcagctctggtccgaagcgtgatccctacgcccgtgagttgcaaaagccgtttccaagc
gactgcatcatccgaaagacggactttccctggcacgagacgggcttcgtcacgcctcgg
ttcaacaacttcgtgatctaccagctccacgtcggcaccttctacacgccgaaccttccg
aagaaggcggggaccttcctcgacgtggcccgcaagattccccacctctcccagttgggc
gtgaccgtactacagctcctgccgatccaggagttccagaccgcattcagcctggggtac
aacggcaccgattatttctcccccgagatggatttcgcggtcgaggacgcggacctcaaa
ccttacgttgatgaggtcaactccctccttgatgccaaaagcctgccccgatacaaggtg
gataaccttcgcggggagatgaaccagctcaaggcattgatcgacctctgccacatccac
ggcttggcgatgatcctcgacgttgtctacaaccacgccggtggggatttcggcgatcaa
agcctcttattcttcgaccgtcagccgacttcaggggggaaggcgaagaactccctctac
ttcaacggtagagagcacgccggcggcgaggtgttcgacttcggcaaacccgaggttcgc
gatttcctcatccagaacgccaagttcttcctcgacgaataccgggttgatgggcttcgc
tacgaccaggtgagcgcgattgaccatgacgggtccccgcgcggctggagtttctgccag
gacctgacctcaactctcaaccatcaccggcccagcgcgatcgatcatgccgagtattgg
aacgtaaacccctacgtcgtgaagccgccctccgagggggcgggcttcgatacgaccttg
accgacggcctgcggatcgccattcgcaacgtcatcagcaacgccgctcagccagacgaa
cgaccgctcaacatgtccggcctggcgtcgagcatgtggcccgaagggttcccagaacag
tggcggatcgtgcagggacctgagaaccacgacattgtctatcgggaccgggagcagcgg
gtggcccgcctgggggatttcaacaacccccgttcttggttcggccggagccgggcgagg
gtcgcgacggggatctgcctgacggcgcccgggattccgatgctcttcatggggcaggag
ttcctggaggacaagcagtgggcggatgacatcgagcaccacgccaatttgctcctcttc
tgggcgggggtagagggcagcgacaaacagatgctcgaccatatccgattcacccgtgag
ctcttgggtgtccggtggcagcaacccgccctccggggagaggggttccgtccggtgcac
gtccacgaccagaaccgcgtgctcgccttccaccgatgggtgccgaacgaaggccacgac
gtgatggtggtcgtccacctttcgaccttcaaccgcttcgattaccgaatcggcttcccc
agtggtggggaatggcgggaggtcttcaacagcgacgtctacgagaactgggtcaatccg
ggcaccacggggaatggtgggcgtatcttcgccgaccagaaccccatgcacggcttcgat
tcctcagcgtcgctcgttcttccggcaaatagcgtcatggtgttcgcgagaggttga

DBGET integrated database retrieval system