KEGG   Singulisphaera acidiphila: Sinac_7244Help
Entry
Sinac_7244        CDS       T02393                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
saci  Singulisphaera acidiphila
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:saci00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:saci00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:saci02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9192961..9194553)
Genome map
AA seq 530 aa AA seqDB search
MIDLSELRAAVRAENGVSRRLFLAYGAALSALPLVGARAEAQARRLVFAADPFSLGVASG
DPNDTGVVLWTRLAPKPLDPDGGLPPEAVEVSWEVATDDGMREIVRRGTAVATPQLAHSV
HVEVNGLKPDRWYWYRFRAGDATSPVGRTRTAPEPDATPEQLRFAFASCSHWEQGYFTAY
EHMAKDDLDVAFHLGDYLYEYEGRDNLVRKHAGPKIRTLADYRVRHAQYKSDPHLQAAHA
RCPWVVTWDDHEFENNYASDISATAGIDPVEFLEQRANAYQAYYEAMPLRSRSLPRGPHM
KLYRTLPFGRLATFQVLDTRQYRTDQPNDDRNSDLNDAALSPKNTILGAEQADWLKSALL
RSTGTWNVLAQQVMMGMVGRSRREGEPTRYSMDQWPGYAFERMKLVRFLADRRVPNPVVL
TGDIHSNWVNDLRVDDRKPETPVVATEFVGTSITSGGNGSAEVEGLSAMMAANPGVRFHN
RQRGYVRCTVTPQSWTSDYRIVEDVKSPGAPVRTLSSFVVEAGKPGAQPA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgacctatcagaactgcgtgccgccgtgcgggctgagaatggtgttagccgtcgt
ctgttcctggcctacggggcggccctgtcggctctgccgctcgtcggcgcccgggccgag
gcccaggcacgccgccttgtctttgccgccgaccccttttcgctaggggtggcttcgggc
gatcccaacgatactggcgtcgtcctgtggactcggctcgcgccgaagccgcttgatccc
gatggcgggctgccaccggaggcggtcgaagtgtcctgggaggtggcaaccgacgatggg
atgcgggagattgtccggcggggcacggccgttgccaccccgcaactcgcccattccgtc
cacgtcgaggtgaacgggctgaagccggaccgttggtactggtaccgcttccgagccggc
gacgcgaccagcccggttggccgcacccgcaccgcccctgagccggacgcgacgccggag
caactgcgattcgcgttcgcgtcttgctcacactgggaacaggggtatttcaccgcctac
gagcacatggccaaagacgatctggacgtggcgttccacctgggcgactacctctacgaa
tatgaggggcgggacaacctggtccgcaagcacgccgggccgaagattcgcaccctcgcc
gactaccgggtccggcacgcccagtacaagtccgacccccacttgcaggctgcccacgcc
cgttgcccctgggtcgtcacctgggacgatcacgagtttgagaacaactacgccagtgac
atttcggcgacggccggaatcgacccggtcgagttcctggagcaacgggcgaacgcctac
caagcctactatgaggcgatgccgctccgctcccgctccttgccgcgcgggccgcacatg
aagctgtaccggaccctccccttcggccgcctggcaacgttccaggtgctggacacccgt
cagtaccgcaccgatcagccgaacgacgaccgcaactcggatctgaacgatgccgccctg
agcccgaagaacacgatcctcggggctgaacaggccgattggttgaagtcggcgctcctg
cgttcgaccggcacctggaacgtcctcgcccagcaggtaatgatggggatggtcgggcgg
agtcggcgggagggcgagccgacccggtactcgatggaccagtggccgggctacgcgttc
gagcggatgaagttggttcggttcctcgccgaccgccgcgtgccgaacccggtggtgctg
accggcgacatccattccaactgggtcaacgacttgcgcgtcgatgaccgcaagccggag
actcctgtggttgccacggaattcgtcggcacgtcgatcaccagcggtggcaacggctcc
gccgaggtggaggggctgagtgcgatgatggccgccaatccgggggtccggttccacaac
cgtcagcggggctacgtgcggtgtaccgtcacgccccagtcatggacgagcgactatcgc
atcgtcgaggacgtcaagtcgcccggagccccggtgcggacgctgagttcgttcgtcgtc
gaagccggcaagccaggggcgcagccggcctga

DBGET integrated database retrieval system