KEGG   Sulfolobus acidocaldarius N8: SacN8_01330Help
Entry
SacN8_01330       CDS       T02452                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sacn  Sulfolobus acidocaldarius N8
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sacn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SacN8_01330
Enzymes [BR:sacn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SacN8_01330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(229246..230112)
Genome map
AA seq 288 aa AA seqDB search
MIVVVGSYNVDFLIKVRDFPSEGETVFSDGVYIDHGGKGSNQAVSASRLGGNVRLISAVG
NDEFGKRAIKFWEDERLDVAYVKIKNALTGSAYIVFDRRGRNFIVVNRGANALLSEDDLD
GCLNGDILLTQLEVNENVVKKALKEFPGVKVLNPAPAVLNDNSLLEYVDILTPNEIEFKE
LTGTQDLNYGIDLLLKKVKRAVIVTLGERGAYIGTRERRILIPTLAVDAIDTTGAGDVFN
ASLAVYLEKGYSLERAVRISNIISAYSTTRIGALGPRLSEVSELIEKE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgattgttgtcgttggaagttataatgtggattttctaattaaggttagagacttcccg
tcagagggagaaacagttttcagcgatggtgtctatatagatcacggagggaagggctca
aatcaagctgtatctgcatcaagactaggtggaaacgttaggttaatctctgcagtgggt
aatgacgagttcggaaaaagggctataaaattttgggaggacgagaggttagatgttgcg
tatgtgaaaattaaaaacgcgttaacagggtctgcttatatagtctttgataggagaggg
aggaacttcatagtcgtgaatagaggagcaaacgctctcctcagcgaggacgacttagat
ggatgtttaaatggagatattttacttacacaattggaagtgaacgagaacgttgtcaag
aaagcattgaaggagttccccggtgttaaagtactaaatccagcccccgctgttcttaat
gacaactccctgcttgagtacgttgacatattaactccaaatgaaattgagtttaaggaa
ttaacaggtactcaagatttgaactacggaatagacttactcttaaagaaagttaagaga
gcagtaatagtaacgttaggtgaaaggggagcttatataggcacaagggagaggagaatt
ttaatccctacactcgcagtagacgctattgatactacaggagctggtgatgtgtttaat
gcatccctggcagtttaccttgaaaagggctatagtttagagagggcggtgagaatctct
aacataatctcagcgtattcaactacaaggataggtgccttaggacccaggttgagcgag
gtgagtgaactaattgagaaagagtga

DBGET integrated database retrieval system