KEGG   Sulfolobus acidocaldarius N8: SacN8_03790Help
Entry
SacN8_03790       CDS       T02452                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sacn  Sulfolobus acidocaldarius N8
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sacn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
624044..624706
Genome map
AA seq 220 aa AA seqDB search
MKILLLRPENSRIPVLNNVEIINIPIFEIRCVKYDNEILNQIDGIGFTSVNGVMCFKDFD
RIRLSKIYAVGRSTAMAIMNKGFPDVKVPTEFTVNSMIQLMLNDGLKNPVVVRSKVGYER
DRELIRNVVFLVDYDLEVIEHNLERAKSLIKECRVDIVVVTSSKIASLIKDSISNCIKIV
SIGPITSSALEGVNNIYEAKQHDINGVLNIISDLLRDSNG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcttctgttacgacctgaaaattctaggatacctgttttaaataacgtagaa
attataaatattcctattttcgagattcgttgtgtgaaatatgataatgagattcttaat
caaattgacggaattggatttactagtgtaaatggcgttatgtgttttaaggattttgat
cgtattcgcctcagtaaaatttacgctgtaggtagatcaactgcaatggcaataatgaat
aaggggtttcctgatgtaaaggttcccacagaatttacagtgaatagtatgattcagtta
atgttaaatgatgggttaaaaaaccctgtagttgtgagaagtaaggtaggatatgaaaga
gatcgagaattgataaggaatgttgtttttcttgtcgactatgaccttgaagttattgag
cataatctcgaacgtgcaaaatcactcattaaagaatgtagagtagatattgtggtagtt
actagttccaagatagcaagtttaataaaagattctatatctaattgcatcaaaatagta
agtataggaccaattacttcatctgctttagaaggagtaaataatatatatgaagcaaag
caacatgatataaacggagttttaaatataatatctgacttgttgagggatagtaatgga
tga

DBGET integrated database retrieval system