KEGG   Sulfolobus acidocaldarius N8: SacN8_03790Help
Entry
SacN8_03790       CDS       T02452                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sacn  Sulfolobus acidocaldarius N8
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sacn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SacN8_03790
Enzymes [BR:sacn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SacN8_03790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
624044..624706
Genome map
AA seq 220 aa AA seqDB search
MKILLLRPENSRIPVLNNVEIINIPIFEIRCVKYDNEILNQIDGIGFTSVNGVMCFKDFD
RIRLSKIYAVGRSTAMAIMNKGFPDVKVPTEFTVNSMIQLMLNDGLKNPVVVRSKVGYER
DRELIRNVVFLVDYDLEVIEHNLERAKSLIKECRVDIVVVTSSKIASLIKDSISNCIKIV
SIGPITSSALEGVNNIYEAKQHDINGVLNIISDLLRDSNG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcttctgttacgacctgaaaattctaggatacctgttttaaataacgtagaa
attataaatattcctattttcgagattcgttgtgtgaaatatgataatgagattcttaat
caaattgacggaattggatttactagtgtaaatggcgttatgtgttttaaggattttgat
cgtattcgcctcagtaaaatttacgctgtaggtagatcaactgcaatggcaataatgaat
aaggggtttcctgatgtaaaggttcccacagaatttacagtgaatagtatgattcagtta
atgttaaatgatgggttaaaaaaccctgtagttgtgagaagtaaggtaggatatgaaaga
gatcgagaattgataaggaatgttgtttttcttgtcgactatgaccttgaagttattgag
cataatctcgaacgtgcaaaatcactcattaaagaatgtagagtagatattgtggtagtt
actagttccaagatagcaagtttaataaaagattctatatctaattgcatcaaaatagta
agtataggaccaattacttcatctgctttagaaggagtaaataatatatatgaagcaaag
caacatgatataaacggagttttaaatataatatctgacttgttgagggatagtaatgga
tga

DBGET integrated database retrieval system