KEGG   Sulfolobus acidocaldarius N8: SacN8_04960Help
Entry
SacN8_04960       CDS       T02452                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sacn  Sulfolobus acidocaldarius N8
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sacn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SacN8_04960
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SacN8_04960
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SacN8_04960
Enzymes [BR:sacn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SacN8_04960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(823079..824092)
Genome map
AA seq 337 aa AA seqDB search
MVNIKCSRCGKERESLHEIKCKKCGGVFEVEIDFEFRKENLKDNFPYIREWVTLGEGNTP
LIRRGKVWFKLDFLNPTGSYKDRGSVTLISYLASNGIKDIAEDSSGNAGASIAAYGKAAG
MNVTIFVPETARGNKVKQIEAYGAKLMKVSGTRDDVTKAAEKSGYYYASHVFQPHFRDGI
RSLAYEIVRDLNWKIPEKVFIPVSAGTLLMGVYSGFKHLMESGVIEKIPTIVAVQTKQVM
PVCAKLNNLSYAPPAKVTSIADALVSTNPALLQEMTDVLQNYGECRVVDDNQITEAWKEL
TKIGLLVEYSSATVYASLRKDDENSVLVLTGNGLKVL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatattaaatgctcaaggtgtggaaaggaaagagaaagtttacatgaaataaaa
tgtaaaaaatgcggtggagtatttgaggtagagattgattttgagttcagaaaggaaaat
ctcaaggataacttcccctacataagggaatgggtaactttaggagaaggcaatactcca
cttattagaaggggaaaagtctggttcaaactagatttcttaaaccctacaggctcctat
aaggacagaggaagtgtcacgctaatctcttacttggcttctaatggaataaaggatata
gcagaggactcctcaggaaatgcaggagcatcaattgcagcttacggaaaggctgcaggc
atgaatgtaactatttttgtccctgagacagccaggggaaataaggttaaacagatagaa
gcttatggagcaaaattgatgaaagtgagcggaacaagagatgacgtaactaaggcagca
gaaaaatcaggatattattatgcctcccacgtatttcagccccatttcagagatggaatc
aggagtctagcttatgaaatagtcagggatttaaattggaaaattcctgagaaagtattc
ataccggtctctgctggtacactcttaatgggagtctactctggtttcaaacatctcatg
gaaagtggtgtcatagaaaagattcctaccatagtagctgtccagaccaaacaagtcatg
ccagtttgcgctaaacttaacaatttaagctatgcaccaccagccaaagtgacttcaata
gcagacgcgttagtctccactaatccagcactattacaggaaatgacagatgtgttacag
aattatggtgagtgcagagtagtagatgataaccaaataacggaagcgtggaaggagctt
actaagataggcttacttgttgaatatagttccgctacagtttatgcgtccttaagaaaa
gatgacgaaaattctgtcttagtactcacaggaaacgggttaaaggttttataa

DBGET integrated database retrieval system