KEGG   Sulfolobus acidocaldarius N8: SacN8_04960Help
Entry
SacN8_04960       CDS       T02452                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sacn  Sulfolobus acidocaldarius N8
Pathway
sacn00260  Glycine, serine and threonine metabolism
sacn00750  Vitamin B6 metabolism
sacn01100  Metabolic pathways
sacn01110  Biosynthesis of secondary metabolites
sacn01120  Microbial metabolism in diverse environments
sacn01230  Biosynthesis of amino acids
Module
sacn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sacn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SacN8_04960
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SacN8_04960
Enzymes [BR:sacn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SacN8_04960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP HypA DFP Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: AGE70963
UniProt: M1I462
Position
complement(823079..824092)
Genome map
AA seq 337 aa AA seqDB search
MVNIKCSRCGKERESLHEIKCKKCGGVFEVEIDFEFRKENLKDNFPYIREWVTLGEGNTP
LIRRGKVWFKLDFLNPTGSYKDRGSVTLISYLASNGIKDIAEDSSGNAGASIAAYGKAAG
MNVTIFVPETARGNKVKQIEAYGAKLMKVSGTRDDVTKAAEKSGYYYASHVFQPHFRDGI
RSLAYEIVRDLNWKIPEKVFIPVSAGTLLMGVYSGFKHLMESGVIEKIPTIVAVQTKQVM
PVCAKLNNLSYAPPAKVTSIADALVSTNPALLQEMTDVLQNYGECRVVDDNQITEAWKEL
TKIGLLVEYSSATVYASLRKDDENSVLVLTGNGLKVL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatattaaatgctcaaggtgtggaaaggaaagagaaagtttacatgaaataaaa
tgtaaaaaatgcggtggagtatttgaggtagagattgattttgagttcagaaaggaaaat
ctcaaggataacttcccctacataagggaatgggtaactttaggagaaggcaatactcca
cttattagaaggggaaaagtctggttcaaactagatttcttaaaccctacaggctcctat
aaggacagaggaagtgtcacgctaatctcttacttggcttctaatggaataaaggatata
gcagaggactcctcaggaaatgcaggagcatcaattgcagcttacggaaaggctgcaggc
atgaatgtaactatttttgtccctgagacagccaggggaaataaggttaaacagatagaa
gcttatggagcaaaattgatgaaagtgagcggaacaagagatgacgtaactaaggcagca
gaaaaatcaggatattattatgcctcccacgtatttcagccccatttcagagatggaatc
aggagtctagcttatgaaatagtcagggatttaaattggaaaattcctgagaaagtattc
ataccggtctctgctggtacactcttaatgggagtctactctggtttcaaacatctcatg
gaaagtggtgtcatagaaaagattcctaccatagtagctgtccagaccaaacaagtcatg
ccagtttgcgctaaacttaacaatttaagctatgcaccaccagccaaagtgacttcaata
gcagacgcgttagtctccactaatccagcactattacaggaaatgacagatgtgttacag
aattatggtgagtgcagagtagtagatgataaccaaataacggaagcgtggaaggagctt
actaagataggcttacttgttgaatatagttccgctacagtttatgcgtccttaagaaaa
gatgacgaaaattctgtcttagtactcacaggaaacgggttaaaggttttataa

DBGET integrated database retrieval system