KEGG   Sulfolobus acidocaldarius N8: SacN8_08285Help
Entry
SacN8_08285       CDS       T02452                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sacn  Sulfolobus acidocaldarius N8
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sacn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SacN8_08285
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SacN8_08285
Enzymes [BR:sacn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SacN8_08285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1465082..1465636
Genome map
AA seq 184 aa AA seqDB search
MFRINEKDIPDVLVIETDKYEDERGLLMELFKRSNFIFIDSIVQVNYSYSKKGVIRGLHY
QLKPKEQGKLVTVIDGKIYDVAVDIRRGSPWYGKFVSEILVPGKMLWIPPGFAHGFQALE
NSHVVYFISGNDFSPPSEAGIRYDDPDIGVNWPIQNPIVSQKDLRWPSLKECKNNFEYVP
HNKK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaataaatgagaaagatattcctgatgttcttgttatagagaccgataaatat
gaagatgagagggggttattgatggagctattcaagaggtctaacttcattttcatcgat
agtatagtccaagttaactactcttactctaagaaaggggtaataagggggttacattac
caactaaagcccaaagaacagggtaaactagttacagtgatcgatggtaagatatacgat
gtagctgtagacattagaagaggatcaccgtggtatggaaagtttgttagcgagatctta
gtcccagggaagatgttgtggataccgccaggttttgctcacggttttcaagctctggag
aactctcatgttgtttacttcatctctggaaacgatttttctcctcccagtgaggcagga
ataagatatgacgacccagatataggagtgaactggccaatacagaaccctatcgtatca
caaaaggacttaaggtggcctagccttaaggagtgtaaaaacaactttgaatatgtacct
cacaacaagaagtaa

DBGET integrated database retrieval system