KEGG   Sulfolobus acidocaldarius N8: SacN8_10675Help
Entry
SacN8_10675       CDS       T02452                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sacn  Sulfolobus acidocaldarius N8
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sacn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SacN8_10675
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SacN8_10675
Enzymes [BR:sacn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SacN8_10675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1981208..1982521
Genome map
AA seq 437 aa AA seqDB search
MNIRDIWNEETRRIEQEWSEDPRWKGIKRNYTASDVVKLRGSVRIEYTLARLGAQKLWKL
LNTEPYVATFGALTGSQAVEMAKAGLKAIYVSGWQVAADNNLSNQTYPDLSLYPSNSVPN
LVRRLNNALLRADQISWSEGKRDVDYLLPIVADAEAGFGGPIHAFELTKAMIEAGAAGVH
FEDQLASEKKCGHLGGKVLIPTGAFIRVLNAARLASDVLGVPTILIARTDALNAAYLSND
IDERDTAFLTGKRTPEGYYEVKGGIEYTIARGLAYAPYADLLWFETSRPDLDEAKQFADA
IHAHFPGKMLAYNLSPSFNWKKFMDDSKIGKFIEELGDMGYKFQFITLAGWHLINYHTFT
LAKAYKNEGMLGYVRLQELEFQAQREGYTAVSHQREVGTEYFDLVLTIASGGNASTTAMK
GSTEAEQFVQVEQKARK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
ttgaatataagagatatatggaatgaggaaacaaggagaattgaacaggagtggtcagaa
gaccctagatggaaaggaattaagagaaattacacagcttctgatgtggtaaagttaaga
ggatctgttagaattgaatatactttagcaagattaggggctcaaaagttgtggaagtta
ttaaacactgagccctatgttgccacctttggtgccttaacaggctcccaagcggtggag
atggcaaaagcaggattaaaggctatatacgtaagcggatggcaagtggctgcagataat
aacttatcaaatcagacttatcctgatttaagcttatacccctctaatagtgtaccgaac
ctggtaaggaggttaaacaatgcgttattaagagcagaccaaatatcttggagtgaagga
aaacgagatgtagattacctattacctattgtagctgatgcagaggctggctttggtggt
cctattcatgcatttgaactaacaaaggctatgattgaagccggtgcagctggtgtacac
tttgaggatcagttagcttccgaaaagaaatgtggtcatttgggtggaaaagtactgatt
cccacaggtgcattcataagagtactaaatgcagctagactagcttcagatgtcttaggt
gtaccgacaatattaattgcaagaacagatgcgttaaacgctgcatacttatctaacgat
attgatgagagagatactgccttcttgactggaaaaagaactcccgaaggttattatgag
gttaaaggtggcatagaatacacaatcgcgaggggattagcctatgcgccttatgctgat
ttactgtggtttgagacatcacgcccagacttagatgaggctaagcaatttgcagacgct
atacacgcccatttcccaggaaaaatgttggcctataacctgtccccctctttcaactgg
aagaaatttatggacgactctaagattggtaagttcatagaggaattgggtgacatgggt
tacaagttccagttcataaccctagcaggctggcacttgataaactaccacacatttaca
ctagcaaaagcctacaagaacgaaggaatgctaggttacgtgaggttacaggagctggag
ttccaggctcaacgcgaaggatacaccgcagtcagccaccaaagagaagtaggaaccgaa
tacttcgacctagtactaacaatagcctccggaggaaacgcatcaaccacagcaatgaaa
ggatcaactgaagcagagcagttcgttcaagtagaacaaaaagcaagaaaatga

DBGET integrated database retrieval system