KEGG   Sulfolobus acidocaldarius Ron12/I: SacRon12I_02690Help
Entry
SacRon12I_02690   CDS       T02453                                 

Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sacr  Sulfolobus acidocaldarius Ron12/I
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sacr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SacRon12I_02690
Enzymes [BR:sacr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SacRon12I_02690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
450977..451840
Genome map
AA seq 287 aa AA seqDB search
MKPLHLSVGRINIDIIAKINKIPDIDEFETTDTLEILPGGAAVNYAVAINKFGHSIKILS
KIGKDSLVSYVLERIAEMGVGLDYVEETNLPQSMALIFLRDNGSISMVRKLGSSILLDKE
DIKKVFGLFDVIHFASISPDIVVRDPYAKLITYDPGPNSSKIPENFGNADIIYLNEREST
KVKIESLKARLIVIKMGSKGAKVISENEECYCEPYKVQTVLDTTGAGDVFDAAFNYAYVQ
GYSIEDTLRFAVTASALKVMRIGGINSPTREEVMNALNAYTPNTKCK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacttcacttgtcagtaggcaggataaacattgatattatagctaagattaac
aaaatacctgatatcgatgagtttgaaacaacagatacactagaaattttaccaggtgga
gcagcagttaattatgctgtagctataaacaaatttggtcacagtattaagattttatct
aagataggcaaagattcacttgtgtcttatgtactagaaaggatagcagaaatgggagta
ggacttgattacgtagaggaaacaaacttaccacagagcatggcattaatatttttgaga
gataacggaagcatttcaatggtcaggaagctaggctcttcaattctccttgataaagag
gatataaagaaagtcttcgggctatttgatgttatacattttgcttcaatttctccggat
attgttgttagggatccttacgctaaacttataacttatgatccaggtccaaatagttca
aaaattcctgaaaattttgggaatgcagatataatatatttgaatgagagggaaagcact
aaggttaagatagaaagtcttaaagcacgattgatcgtaataaaaatgggatcgaaggga
gctaaagtaatatcagaaaatgaagagtgctattgcgagccatataaagttcaaactgtt
ttagatacaacaggtgctggagatgtttttgacgccgcatttaattatgcgtatgtgcag
ggatactcaatagaggatactcttagattcgctgtaactgcctctgcactaaaagtaatg
agaataggagggataaattctcccactagagaggaagttatgaatgccttaaatgcttat
acaccaaatactaaatgtaaatga

DBGET integrated database retrieval system