KEGG   Sulfolobus acidocaldarius Ron12/I: SacRon12I_05050Help
Entry
SacRon12I_05050   CDS       T02453                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
sacr  Sulfolobus acidocaldarius Ron12/I
Brite
Enzymes [BR:sacr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SacRon12I_05050
Transfer RNA biogenesis [BR:sacr03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    SacRon12I_05050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(844054..845448)
Genome map
AA seq 464 aa AA seqDB search
MLIKKPVRMISGVTIVSVMTHPHRCPHGKCIFCPGGVEYGTPQSYYGNEPTLMRAIENNY
EPFYQVQSRLRQYEANGHNPSKIELIIMGGTFLATPLDYQDWFVTQALEAMNRYPSNQKP
GFILLEDAQLRNETASIRCVGLTVETKPDWSKEVHAKQMLRLGVTKVELGVQTVFDDLLT
KSNRGHTVKDSIEATKILKDNGFKVVYHMMLGLPGSDPDKDLESFERIFSDPDFSPDMLK
IYPTLVVETAPLAELWKKGLYKPYDTETLVELISEIYKLIPPWVRVMRVQRDIPATIIID
GNKKGNLRELVENRAKQKGIKINEIRHREVGIKWIHTGKLPTGEPKLKRYDYEASGGTEV
FLSYEYDDDTLVGYLRLRKPSNKDDVTIVRELHIYGPETPVGLWDDFSFQHKGYGGRLLS
EAERISVEEFDAKKILVLSGIGVREYYRKKGYHNEYPYVAKDLK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgctaatcaaaaagccagttagaatgatctcaggagttacaatagtgtcagtaatgaca
caccctcacagatgccctcatggaaaatgtatattctgcccaggaggtgttgagtatggt
acaccgcagagctattacggaaatgaacctacactaatgagggctatagaaaataattat
gaaccattctaccaagtccaatctcgcctcagacagtatgaggctaatggtcataatccg
agtaagatcgagcttataatcatggggggaacatttctcgctactcccttagattatcaa
gattggtttgttactcaagccctagaagctatgaatagatatccctctaaccagaaacct
ggtttcatactcttagaggacgcacaactgagaaacgagactgcgtcaattagatgtgtt
ggattaaccgtagaaacaaaaccggactggagtaaagaagttcatgctaagcaaatgctt
agacttggagtgacaaaagttgaactgggagttcaaacagtgtttgatgatctgttgacg
aaaagtaacaggggtcatacggttaaagactcaatagaagctactaaaattctaaaagat
aatggatttaaagtagtatatcacatgatgcttggcttgcccggcagcgaccctgataag
gatctggagtcatttgagagaatattttctgatcctgatttttcaccagatatgttgaaa
atatatccaacactagtagtagaaacagcaccattagctgaactgtggaaaaagggtctt
tacaaaccatatgatactgaaacactagttgaacttatttcagaaatctacaaactgata
ccaccttgggtgagagtaatgagagttcaaagagatatacctgcgacaatcattattgat
ggtaacaagaaaggaaacctcagagaactagtcgagaacagggcaaaacagaagggcatt
aaaatcaacgaaattagacacagagaagtaggaataaagtggatacatacgggaaagtta
cctactggtgaaccaaaattaaagagatatgattatgaagccagtggagggacagaggtg
ttcttatcttacgaatatgacgacgatacactggtgggctatctcaggttaagaaagcca
agtaataaagatgacgtcactatagtgagggagttacatatctacggaccagaaactcca
gtaggactttgggatgatttttccttccaacataagggatatggaggaagattattatca
gaggctgaaagaatatcagtagaggaatttgatgcgaaaaagattctagtgctttcaggg
attggtgttagagaatattacagaaagaagggatatcacaatgaatatccttacgttgca
aaggatttaaaatga

DBGET integrated database retrieval system