KEGG   Sulfolobus acidocaldarius Ron12/I: SacRon12I_06945Help
Entry
SacRon12I_06945   CDS       T02453                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sacr  Sulfolobus acidocaldarius Ron12/I
Pathway
sacr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sacr01100  Metabolic pathways
sacr01110  Biosynthesis of secondary metabolites
sacr01130  Biosynthesis of antibiotics
sacr01230  Biosynthesis of amino acids
Module
sacr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sacr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SacRon12I_06945 (trpC)
Enzymes [BR:sacr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SacRon12I_06945 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth FMN_dh QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AGE73624
UniProt: M1J2H3
Position
1218626..1219372
Genome map
AA seq 248 aa AA seqDB search
MPRFLNGWLTDVVQASLSRPKIEKVRDRPIFSLKKSIISAKNSGLNPIIAEYKRRSPSGI
NVDINIIEYVKFMENNGATGISVLTEEKFFNGSYNDLELVAKNVKLPILMKDFVVSEKQI
DSAYNIGADVILLIAKILTERELVSLYKYAKSYGLEAIVEISDEEDLDVALRGNYDFIGV
NARNLESLEVSLDRTKKLLQMIPKDRLKIAESGISTRQDIEELRASGADAFLIGTSLLKD
QNKIKELI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccgagatttctaaatggttggttaactgatgttgtacaagcctccctctcccgacct
aaaatagaaaaggtaagagatagacctatcttctccttaaaaaaaagtataatttctgct
aagaattcaggattaaatcctataatagcagaatataaaagaaggtctccctctgggata
aatgtagatattaacattatagaatatgtaaaatttatggagaataatggtgcgacagga
ataagtgttttaacagaagaaaagttctttaacggtagttataatgacctggaactagtt
gcaaagaatgtaaaattacccatactaatgaaagattttgtagttagtgaaaaacaaata
gattctgcatacaatataggagcagatgttatattattaatagcaaaaatattgacggag
agagagctggtcagtttatacaagtatgctaaatcttacggactagaggcaatagtagaa
atatcagatgaggaggacttagatgtagctttaagaggtaattatgatttcataggggta
aatgctagaaatcttgagtcactagaggtaagtttagatagaactaaaaaattacttcaa
atgatacctaaggataggttgaaaatagctgaaagtggtattagtactagacaagacatt
gaggaactcagagcttccggtgcagacgctttcctcataggtacatccttattaaaggat
cagaataaaataaaggagttgatttaa

DBGET integrated database retrieval system