KEGG   Sulfolobus acidocaldarius Ron12/I: SacRon12I_07185Help
Entry
SacRon12I_07185   CDS       T02453                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sacr  Sulfolobus acidocaldarius Ron12/I
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sacr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1259631..1260260
Genome map
AA seq 209 aa AA seqDB search
MEQESLNQERLVEEIAKRVKEILQLIGEDTEREGLKETPERVAKALLEMTSALRSPQPYI
KVFSLAENENSSVEDQIVLVKDISFSSLCEHHLLPIIGKVHVAYVVGKSGKVAGLSKIIR
LVNYYASRPQIQERLVEQIAEAIMKSDIQPKGVMVIGDALHMCTYVRGVKDREASLISLS
TRGIFSTKPSLKSQVFRLINTSKKSSTFL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggaaagtttaaatcaagaaagactcgttgaggaaattgcaaagagagttaag
gagattctacagcttattggagaagatactgaaagagagggacttaaggaaacaccagag
agagtagcaaaggctttacttgaaatgacgtcagctttgagatctcctcaaccctatata
aaggtattttccttagcagaaaatgaaaactccagtgtagaagatcaaatagttctagta
aaggacatttcgttctcgtcattatgtgaacatcatttactgccaataataggaaaggtc
catgttgcatatgttgttggtaagagcggaaaggtagctggcttaagtaaaataataagg
cttgtaaattattatgcctcaagaccacagatccaggaaagactagtggaacaaattgca
gaagccattatgaagagtgatattcaaccgaaaggagttatggtaattggagacgcattg
catatgtgcacttatgttagaggggtaaaggatagggaagctagcttaatatcattatcc
actagaggaatattcagtacgaagccttccttgaagagtcaggtatttaggctgattaac
acgtctaagaagtcatcaacttttttatga

DBGET integrated database retrieval system