KEGG   Sulfolobus acidocaldarius Ron12/I: SacRon12I_07670Help
Entry
SacRon12I_07670   CDS       T02453                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sacr  Sulfolobus acidocaldarius Ron12/I
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sacr01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sacr00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1349270..1350451
Genome map
AA seq 393 aa AA seqDB search
MIKYEIPKSRPNEFSKVLPLVEQILNQVKERGDKALLELEEKYDKAKLDSLVENRIDELA
SKIPEEYKAAIDRIYDQLVEFHKTTLPYMVGGGYNGIEFGILWRAIEKVGIYVPGGLKSY
PSTLLMAAIPARVAGVSEIYVATPPNRIDSVIAYIAKKLKINALYRIGGAQAIAALAYGT
ESVKKVDKIVGPGNIFVQASKFLVSKDVAIDGIEGPTELVVIADSSADYRHVILDMRAQA
EHGSTSYIILVTTSDFLIDKVREELDKEEFTYYIVKVKSIDEAIDVANDIAPEHLSLFVN
DPKSYLHKIKNAGAISLGKTPPALIDYAAGPDHILPTNAWSRVRGGLTVYDFLKPISYAN
SVNPDKELVNMAKLIAEYEGFIYHSKSIGARYE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaaatatgagataccaaaatctagaccaaacgaatttagtaaagtactcccttta
gtcgaacaaatattaaatcaagttaaggaaagaggagataaagcactattagagttagag
gagaagtacgataaggctaaattagattccttagtcgagaatagaatagatgaactagca
agtaaaataccggaggaatataaggctgccatagacagaatctatgatcagcttgttgaa
tttcataagacaactctaccatatatggtagggggaggatataacggaatagaatttggt
atactttggagagcaattgagaaagttggtatatatgtacctggaggattgaagtcttat
ccctctacgttgttgatggctgcaattcctgctagagtagcaggagttagtgaaatttat
gtggcaaccccgccaaatagaatagactctgtaattgcatatatagctaaaaaactaaaa
attaatgcgttatatagaattggtggagctcaggcaatagctgcactagcttatggaact
gagagtgtgaaaaaggtagataaaattgtaggtccgggaaatatttttgtccaagcatcg
aagtttttggttagcaaagatgtggcaattgatggaatagagggaccaactgaactagtt
gttatagcagatagttcagcagattataggcatgttatattggatatgagagcacaagcg
gaacatggatctacatcttatataatactagttaccacttcagatttcctaattgataaa
gtaagagaggaattagataaggaggagtttacgtattatattgtcaaggtcaagagtata
gatgaagcgatagatgtggcaaacgatatagcgccagaacatttgtcgttgtttgtaaat
gatcctaaatcttatttacataagattaagaatgctggtgcaataagtctaggtaaaaca
cctccagcactgatagactatgcagctggtcctgatcacatacttccgacaaatgcttgg
tccagggtaagaggaggtttaactgtttatgacttcttgaagcccatttcctacgccaat
tccgtaaatcctgataaggaacttgtaaatatggcaaagttgatagctgagtacgagggt
ttcatatatcactctaagagcataggtgctaggtatgagtga

DBGET integrated database retrieval system