KEGG   Sulfolobus acidocaldarius Ron12/I: SacRon12I_08295Help
Entry
SacRon12I_08295   CDS       T02453                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sacr  Sulfolobus acidocaldarius Ron12/I
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:sacr00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sacr00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1465089..1465643
Genome map
AA seq 184 aa AA seqDB search
MFRINEKDIPDVLVIETDKYEDERGLLMELFKRSNFIFIDSIVQVNYSYSKKGVIRGLHY
QLKPKEQGKLVTVIDGKIYDVAVDIRRGSPWYGKFVSEILVPGKMLWIPPGFAHGFQALE
NSHVVYFISGNDFSPPSEAGIRYDDPDIGVNWPIQNPIVSQKDLRWPSLKECKNNFEYVP
HNKK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaataaatgagaaagatattcctgatgttcttgttatagagaccgataaatat
gaagatgagagggggttattgatggagctattcaagaggtctaacttcattttcatcgat
agtatagtccaagttaactactcttactctaagaaaggggtaataagggggttacattac
caactaaagcccaaagaacagggtaaactagttacagtgatcgatggtaagatatacgat
gtagctgtagacattagaagaggatcaccgtggtatggaaagtttgttagcgagatctta
gtcccagggaagatgttgtggataccgccaggttttgctcacggttttcaagctctggag
aactctcatgttgtttacttcatctctggaaacgatttttctcctcccagtgaggcagga
ataagatatgacgacccagatataggagtgaactggccaatacagaaccctatcgtatca
caaaaggacttaaggtggcctagccttaaggagtgtaaaaacaactttgaatatgtacct
cacaacaagaagtaa

DBGET integrated database retrieval system