KEGG   Sulfolobus acidocaldarius SUSAZ: SUSAZ_00275Help
Entry
SUSAZ_00275       CDS       T02975                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sacs  Sulfolobus acidocaldarius SUSAZ
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sacs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SUSAZ_00275
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SUSAZ_00275
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SUSAZ_00275
   00680 Methane metabolism
    SUSAZ_00275
Enzymes [BR:sacs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SUSAZ_00275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
44320..45855
Genome map
AA seq 511 aa AA seqDB search
MRKIPRTMSTQHPDNAKVPEWNQGEAISGENEIIEAYLAFSRYGVEEVMWDAEGKDVDTH
VVRKLLSQYPEFFRHRILGKDIFLTYRVPNPKIEGAERKVFAETLNTIPITYDLAEKFYG
ENPNPPVFEVILPFTTSYEELIAVIKFYEKVIVNSDNTKLVDDTYVKDIIGETNPKKIEV
IPLIEDRDSMLRIDTIVGKYIEIERPPYLRVFLARSDPAMNYGLLSAVLSVKYALSRLSK
MEKIYGVKIFPLLGVGSLPFRGHFSPYNVENTLNEYRGIYTFTVQSAFKYDYEDDLVISA
IKKVNGTNVTEKIELSEEDEEIISNVTRKYTQGYQNKIEALADVINKVALLLPRRRARKL
HIGLFGYSRSTGKVTLPRAISFVGSLYTIGIPPEIIGLSSLSKMTNQELHAIFSNYKYLK
NDLQFAARFVNLEGLQLLKDIWSVDAEVVKAIKEDIDYAENNLGIRIGESDYMSKKHVLL
STLALLSIKEGKLDEAKTYIKEMAIVRRAIG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatacctaggactatgtcaacacagcaccctgataacgcaaaagttcctgaa
tggaaccaaggagaagcaatcagcggtgaaaacgagattattgaggcatatttggctttt
tccagatatggcgtggaagaggtgatgtgggatgccgaaggtaaggacgtggacactcat
gtagtgagaaaattactaagtcaatacccagaatttttcagacacaggatattaggcaag
gatattttcttgacgtatagggttccaaatccaaaaatagagggtgctgagagaaaagtc
tttgctgaaacgctaaatactataccaataacatatgacttagctgagaagttttatggc
gaaaatcctaatccaccagtctttgaagttatcttaccttttacaactagttatgaagag
ttaattgcagtcatcaagttttatgagaaagtaatagttaacagtgacaatacgaagcta
gttgatgatacatatgtgaaggatattataggtgagacaaatcctaagaagatcgaagta
attcctctaatagaagatagagattcaatgttaagaatagatacaatagttgggaaatac
atagaaatagagagaccaccttatctgagagtgttcttagcaagatctgatccagctatg
aattatggtttgttgtcagctgttctatcagtgaaatacgcattaagcagactttcgaaa
atggaaaagatttatggagtgaagatatttcctttactcggagtcggttctttacccttc
agaggtcattttagtccatataatgttgaaaatactttgaatgaatacagaggcatatat
acctttactgttcaatcagctttcaaatatgactatgaagatgaccttgtgatcagtgca
ataaagaaagtaaatgggactaacgtaaccgaaaaaattgaattaagtgaggaagatgag
gagatcatttctaacgtaacaagaaaatacacacaaggttatcagaataagatagaggca
ttagccgatgttataaacaaagtggcattactacttcctagaagaagagccagaaaattg
cacataggtttatttggatattcaagaagtacaggtaaggtaacactacctagagctatt
tcctttgttggctctctatatactataggtattccacctgagattatagggctttcctct
ctatcaaaaatgactaatcaagagcttcatgccatattcagtaattacaaatatttgaag
aatgatctgcagttcgcagcccgttttgttaacttagaaggtctccagttactcaaagat
atatggagtgttgatgcagaggttgtcaaagctataaaggaagatatagactatgcagaa
aataatctgggaattagaataggcgaaagtgattatatgagcaaaaaacacgttctactc
tctaccctggcactattgtccataaaagagggtaaattggacgaggctaaaacgtatata
aaagaaatggctatagtaagaagagcaataggatga

DBGET integrated database retrieval system